POU5F1P1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: POU5F1P1 Antibody [NBP2-55475] - Staining of human cell line RT4 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POU5F1P1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VGPGSEVWGIPPCPPPYELCGGMAYCGPQVGVGLVPQGGLETSQPESEAGV
Specificity
Specificity of human POU5F1P1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POU5F1B
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for POU5F1P1 Antibody

  • OCT4-PG1
  • Octamer-binding protein 3-like
  • Octamer-binding transcription factor 3-like
  • OTF3Coctamer binding protein 3_like sequence
  • OTF3P1
  • POU 5 domain protein
  • POU class 5 homeobox 1 pseudogene 1
  • POU class 5 homeobox 1B
  • POU domain class 5, transcription factor 1 pseudogene 1
  • POU domain transcription factor Oct-4
  • POU domain transcription factor OCT4-pg1
  • POU domain, class 5, transcription factor 1 pseudogene 1
  • POU5F1P1
  • POU5F1P4
  • POU5FLC20
  • POU5FLC8
  • putative POU domain, class 5, transcription factor 1B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-55386
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ye
Applications: WB, ICC/IF, IHC
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Rb, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE, KO
NBP1-86676
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02956
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47459
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
AF2498
Species: Mu
Applications: WB, IP
NBP2-55475
Species: Hu
Applications: ICC/IF

Publications for POU5F1P1 Antibody (NBP2-55475) (0)

There are no publications for POU5F1P1 Antibody (NBP2-55475).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU5F1P1 Antibody (NBP2-55475) (0)

There are no reviews for POU5F1P1 Antibody (NBP2-55475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POU5F1P1 Antibody (NBP2-55475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POU5F1P1 Products

Bioinformatics Tool for POU5F1P1 Antibody (NBP2-55475)

Discover related pathways, diseases and genes to POU5F1P1 Antibody (NBP2-55475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU5F1P1 Antibody (NBP2-55475)

Discover more about diseases related to POU5F1P1 Antibody (NBP2-55475).

Blogs on POU5F1P1

There are no specific blogs for POU5F1P1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POU5F1P1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POU5F1B