Recombinant Human POT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POT1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 95 of Human POT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POT1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells. Customer review also reported success in ICC staining.
Reviewed Applications
Read 1 Review rated 4
using
H00025913-Q01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POT1 Protein

  • DKFZp586D211
  • HPOT1
  • POT1 protection of telomeres 1 homolog
  • POT1
  • POT1-like telomere end-binding protein
  • protection of telomeres 1 homolog (S. pombe)
  • protection of telomeres protein 1

Background

POT1 - POT1 protection of telomeres 1 homolog (S. pombe)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31758
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1522
Species: Hu, Mu
Applications: WB, GS, ICC/IF
NBP2-14870
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-186
Species: Hu
Applications: WB, ICC/IF
NB100-471
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
H00025913-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POT1 Partial Recombinant Protein (H00025913-Q01) (0)

There are no publications for POT1 Partial Recombinant Protein (H00025913-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for POT1 Partial Recombinant Protein (H00025913-Q01) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: ICC.

Reviews using H00025913-Q01:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry POT1 H00025913-Q01
Enlarge
reviewed by:
Anonymous
ICC Human 09/22/2010
View

Summary

ApplicationImmunocytochemistry
Sample TestedH00025913-Q01
SpeciesHuman
Lot0990727
CommentsNeed to optimize the buffer conditions but I think it will work better.

Primary Anitbody

Dilution RatioIncubation Dilution Buffer: protein binding buffer, Incubation Time: 20 minutes, Incubation Temp: 37 degrees Celsius

Details

Detection NotesDetection Visualization Method: radiological

Comments

CommentsNeed to optimize the buffer conditions but I think it will work better.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POT1 Partial Recombinant Protein (H00025913-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POT1 Products

Bioinformatics Tool for POT1 Partial Recombinant Protein (H00025913-Q01)

Discover related pathways, diseases and genes to POT1 Partial Recombinant Protein (H00025913-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POT1 Partial Recombinant Protein (H00025913-Q01)

Discover more about diseases related to POT1 Partial Recombinant Protein (H00025913-Q01).
 

Pathways for POT1 Partial Recombinant Protein (H00025913-Q01)

View related products by pathway.

PTMs for POT1 Partial Recombinant Protein (H00025913-Q01)

Learn more about PTMs related to POT1 Partial Recombinant Protein (H00025913-Q01).
 

Research Areas for POT1 Partial Recombinant Protein (H00025913-Q01)

Find related products by research area.

Blogs on POT1.

Application Highlight: Recent uses of TERF2 in immunofluorescence (IF)
Telomeres are a region of repeat nucleotide sequences located at the end of chromosomes to protect our DNA from becoming damaged via end-to-end fusion.  TERF2, or telomeric-repeat binding factor 2, is important for telomere integrity and aids in th...  Read full blog post.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
POT1 Antibody
NB500-176

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/22/2010
Application: ICC
Species: Human

Bioinformatics

Gene Symbol POT1
Entrez