POPDC3 Antibody - BSA Free

Western Blot: POPDC3 Antibody [NBP2-84225] - WB Suggested Anti-Popdc3 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POPDC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit POPDC3 Antibody - BSA Free (NBP2-84225) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of POPDC3. Peptide sequence: PEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POPDC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POPDC3 Antibody - BSA Free

• bA355M14.1
• MGC22671
• POP3RP11-99L11.2
• popeye domain containing 3
• popeye domain-containing protein 3
• Popeye protein 3

Background

POPDC3 encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development. Alternatively spliced transcript variants have been found. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POPDC3