![Western Blot: RPP38 Antibody [NBP2-13260] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPP38 antibody. Remaining relative intensity is presented](http://images.novusbio.com/fullsize/RPP38-Antibody-Western-Blot-NBP2-13260-img0005.jpg "Western Blot: RPP38 Antibody [NBP2-13260] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPP38 antibody. Remaining relative intensity is presented")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RPP38 Antibody - BSA Free (NBP2-13260) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: FVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLESQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPP38 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry BVES Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4986_human-bves-affinity-purified-polyclonal-ab-immunohistochemistry-257202315566..jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPP38 |
![Immunocytochemistry/Immunofluorescence: RPP38 Antibody [NBP2-13260] - Staining of human cell line U-2 OS shows positivity in nucleoli.](http://images.novusbio.com/fullsize/RPP38-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13260-img0003.jpg "Immunocytochemistry/Immunofluorescence: RPP38 Antibody [NBP2-13260] - Staining of human cell line U-2 OS shows positivity in nucleoli.")
![Western Blot: RPP38 Antibody [NBP2-13260] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPP38 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/RPP38-Antibody-Western-Blot-NBP2-13260-img0004.jpg "Western Blot: RPP38 Antibody [NBP2-13260] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RPP38 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
![Western Blot GBL Antibody [Unconjugated]](https://images.novusbio.com/images2/GBL_AF4004_Western_Blot_5381.jpg)
![Immunohistochemistry GBL Antibody [Unconjugated]](https://images.novusbio.com/images2/GBL_AF4004_Immunohistochemistry_19617.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")