Recombinant Human POMT1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POMT1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 483-580 of Human POMT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LPDWGYRQLEIVGEKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSEHKYSSSPLEWVTLDTNIA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POMT1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POMT1 Protein

  • Dolichyl-phosphate-mannose--protein mannosyltransferase 1
  • EC 2.4.1
  • EC 2.4.1.109
  • FLJ37239
  • LGMD2K
  • MDDGA1
  • MDDGB1
  • MDDGC1
  • protein O-mannosyl-transferase 1
  • protein-O-mannosyltransferase 1
  • RT

Background

O-mannosylation is an important protein modification in eukaryotes that is initiated by an evolutionarily conserved family of protein O-mannosyltransferases. POMT1 shares sequence similarity with protein O-mannosyltransferases of S. cerevisiae. In yeast, these enzymes are located in the endoplasmic reticulum (ER) and are required for cell integrity and cell wall rigidity. POMT1 also shows similarity to the Drosophila 'rotated abdomen' (rt) gene, which when mutated causes defects in myogenesis and muscle structure.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF4036
Species: Hu
Applications: WB, Simple Western
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB4614
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-60082
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00010585-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POMT1 Partial Recombinant Protein (H00010585-Q01) (0)

There are no publications for POMT1 Partial Recombinant Protein (H00010585-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMT1 Partial Recombinant Protein (H00010585-Q01) (0)

There are no reviews for POMT1 Partial Recombinant Protein (H00010585-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POMT1 Partial Recombinant Protein (H00010585-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POMT1 Products

Bioinformatics Tool for POMT1 Partial Recombinant Protein (H00010585-Q01)

Discover related pathways, diseases and genes to POMT1 Partial Recombinant Protein (H00010585-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POMT1 Partial Recombinant Protein (H00010585-Q01)

Discover more about diseases related to POMT1 Partial Recombinant Protein (H00010585-Q01).
 

Pathways for POMT1 Partial Recombinant Protein (H00010585-Q01)

View related products by pathway.

PTMs for POMT1 Partial Recombinant Protein (H00010585-Q01)

Learn more about PTMs related to POMT1 Partial Recombinant Protein (H00010585-Q01).

Blogs on POMT1

There are no specific blogs for POMT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMT1 Antibody
NBP2-57200
IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POMT1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POMT1