POLR3E Antibody

Images

 
Western Blot: POLR3E Antibody [NBP1-84621] - Analysis using Anti-POLR3E antibody NBP1-84621 (A) shows similar pattern to independent antibody NBP2-58956 (B).
Immunocytochemistry/ Immunofluorescence: POLR3E Antibody [NBP1-84621] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Small intestine shows moderate nuclear and cytoplasmic positivity in glandular cells.
Western Blot: POLR3E Antibody [NBP1-84621] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human stomach, lower shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Skin shows strong nuclear and cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: POLR3E Antibody [NBP1-84621] - Staining of human Testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR3E Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FVMWKFTQSRWVVRKEVATVTKLCAEDVKDFLEHMAVVRINKGWEFILPYDGEFIKKHPDVVQRQHMLWTGIQAKLEKVYNLVKETMPKKPDAQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR3E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POLR3E Protein (NBP1-84621PEP)
Publications
Read Publication using NBP1-84621.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLR3E Antibody

  • DNA-directed RNA polymerase III 80 kDa polypeptide
  • DNA-directed RNA polymerase III subunit RPC5
  • FLJ10509
  • KIAA1452
  • polymerase (RNA) III (DNA directed) polypeptide E (80kD)
  • RNA polymerase III 80 kDa subunit RPC5
  • RNA polymerase III subunit C5
  • RPC5
  • SIN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04674
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-89134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1699
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
NBP2-00532
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-81894
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for POLR3E Antibody (NBP1-84621)(1)

Reviews for POLR3E Antibody (NBP1-84621) (0)

There are no reviews for POLR3E Antibody (NBP1-84621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR3E Antibody (NBP1-84621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POLR3E Products

Bioinformatics Tool for POLR3E Antibody (NBP1-84621)

Discover related pathways, diseases and genes to POLR3E Antibody (NBP1-84621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on POLR3E

There are no specific blogs for POLR3E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR3E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3E