POLR1C Antibody (3A5-H2)

Images

 
Western Blot: POLR1C Antibody (3A5-H2) [H00009533-M01] - POLR1C monoclonal antibody (M01), clone 3A5-H2 Analysis of POLR1C expression in K-562.
Immunocytochemistry/ Immunofluorescence: POLR1C Antibody (3A5-H2) [H00009533-M01] - Analysis of monoclonal antibody to POLR1C on HeLa cell. Antibody concentration 7 ug/ml.
Immunohistochemistry-Paraffin: POLR1C Antibody (3A5-H2) [H00009533-M01] - Analysis of monoclonal antibody to POLR1C on formalin-fixed paraffin-embedded human thyroid nodular goiter. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3A5-H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLR1C Antibody (3A5-H2) Summary

Immunogen
POLR1C (AAH08863, 1 a.a. ~ 347 a.a) full length recombinant protein with GST tag.MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQ DRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEV PTMAVEKVLVYNNTSIVQDEILAHRLGLIPIHADPRLFEYRN QGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSDPNELYVNHKV YTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDL LMHCVKGIGKDHAKFSPVATASYRLLPDITLLEPV
Localization
Nuclear
Specificity
POLR1C - polymerase (RNA) I polypeptide C, 30kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLR1C
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR1C Antibody (3A5-H2)

  • AC40
  • DNA-directed RNA polymerase I subunit C
  • DNA-directed RNA polymerases I and III 40 kDa polypeptide
  • POLR1E
  • polymerase (RNA) I polypeptide C, 30kDa
  • RNA polymerase I subunit
  • RPA39RNA polymerases I and III subunit AC1
  • RPA40TCS3
  • RPA5RPAC1DNA-directed RNA polymerases I and III subunit RPAC1
  • RPC40

Background

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP1-87786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-71822
Species: Hu
Applications: WB, IP
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF6380
Species: Mu
Applications: WB
NBP1-86909
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for POLR1C Antibody (H00009533-M01) (0)

There are no publications for POLR1C Antibody (H00009533-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1C Antibody (H00009533-M01) (0)

There are no reviews for POLR1C Antibody (H00009533-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR1C Antibody (H00009533-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for POLR1C Antibody (H00009533-M01)

Discover related pathways, diseases and genes to POLR1C Antibody (H00009533-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1C Antibody (H00009533-M01)

Discover more about diseases related to POLR1C Antibody (H00009533-M01).

Blogs on POLR1C

There are no specific blogs for POLR1C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR1C Antibody (3A5-H2) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1C
Entrez
Uniprot