POLR2C Antibody - BSA Free

Western Blot: POLR2C Antibody [NBP1-80817] - Analysis using Anti-POLR2C antibody NBP1-80817 (A) shows similar pattern to independent antibody NBP1-80818 (B).

Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.

Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex.

Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry: POLR2C Antibody [NBP1-80817] - Staining of human ovary shows nuclear positivity.

Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex, colon, kidney and testis using Anti-POLR2C antibody NBP1-80817 (A) shows similar protein distribution across tissues to independent antibody NBP1-80818 (B).

Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human testis.

Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human colon.

Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLR2C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR2C
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  POLR2C Protein (NBP1-80817PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for POLR2C Antibody - BSA Free

• DNA-directed RNA polymerase II 33 kDa polypeptide
• DNA-directed RNA polymerase II subunit C
• DNA-directed RNA polymerase II subunit RPB3
• hRPB33
• hsRPB3
• polymerase (RNA) II (DNA directed) polypeptide C (33kD)
• polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
• RNA polymerase II subunit 3
• RNA polymerase II subunit B3
• RPB3
• RPB31
• RPB33

Background

The POLR2C gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POLR2C Antibody (NBP1-80817)(1)

Publication using NBP1-80817

• Shearn CT, Anderson AL, Devereux MW et al. The autophagic protein p62 is a target of reactive aldehydes in human and murine cholestatic liver disease PloS one 2022-11-15 [PMID: 36378690] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: POLR2C
• Entrez:
  • 5432(Human)
• Uniprot:
  • P19387(Human)