![Western Blot: RPB8 Antibody [NBP1-80816] - Analysis using Anti-POLR2H antibody NBP1-80816 (A) shows similar pattern to independent antibody NBP2-76548 (B).](http://images.novusbio.com/fullsize/RPB8-Antibody-Western-Blot-NBP1-80816-img0014.jpg "Western Blot: RPB8 Antibody [NBP1-80816] - Analysis using Anti-POLR2H antibody NBP1-80816 (A) shows similar pattern to independent antibody NBP2-76548 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RPB8 Antibody - BSA Free (NBP1-80816) is a polyclonal antibody validated for use in IHC and WB. Anti-RPB8 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | POLR2H |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-80816 | Applications | Species |
|---|---|---|
| Shearn CT, Anderson AL, Devereux MW et al. The autophagic protein p62 is a target of reactive aldehydes in human and murine cholestatic liver disease PloS one 2022-11-15 [PMID: 36378690] (IHC-P, Mouse) | IHC-P | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for RPB8 Antibody (NBP1-80816)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining in human thyroid gland and pancreas tissues using anti-POLR2H antibody. Corresponding POLR2H RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RPB8-Antibody-Immunohistochemistry-Paraffin-NBP1-80816-img0012.jpg "Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining in human thyroid gland and pancreas tissues using anti-POLR2H antibody. Corresponding POLR2H RNA-seq data are presented for the same tissues.")
![Western Blot: RPB8 Antibody [NBP1-80816] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/RPB8-Antibody-Western-Blot-NBP1-80816-img0013.jpg "Western Blot: RPB8 Antibody [NBP1-80816] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/RPB8-Antibody-Immunohistochemistry-Paraffin-NBP1-80816-img0010.jpg "Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining of human thyroid gland shows high expression.](http://images.novusbio.com/fullsize/RPB8-Antibody-Immunohistochemistry-Paraffin-NBP1-80816-img0011.jpg "Immunohistochemistry-Paraffin: RPB8 Antibody [NBP1-80816] - Staining of human thyroid gland shows high expression.")
![Jagged 2 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Jagged 2 [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")