POLR2L Antibody - BSA Free

Immunohistochemistry-Paraffin: POLR2L Antibody [NBP2-93863] - Paraffin-embedded mouse brain using POLR2L .

Immunohistochemistry-Paraffin: POLR2L Antibody [NBP2-93863] - Paraffin-embedded rat brain using POLR2L .

Western Blot: POLR2L Antibody - BSA Free [POLR2L] - Western blot analysis of various lysates, using POLR2L Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLR2L Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-67 of human POLR2L (NP_066951.1). MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POLR2L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 7 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for POLR2L Antibody - BSA Free

• DNA-directed RNA polymerase III subunit L
• DNA-directed RNA polymerases I, II, and III subunit RPABC5
• EC 2.7.7.6
• hRPB7.6
• hsRPB10b
• polymerase (RNA) II (DNA directed) polypeptide L (7.6kD)
• polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa
• RBP10
• RNA polymerase II 7.6 kDa subunit
• RPABC5
• RPB10 homolog
• RPB10
• RPB10beta
• RPB7.6RNA polymerases I, II, and III subunit ABC5

Background

The POLR2L gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POLR2L