POLR1D Antibody

Images

 
Western Blot: POLR1D Antibody [NBP1-82655] - Analysis in control (vector only transfected HEK293T lysate) and POLR1D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: POLR1D Antibody [NBP1-82655] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: POLR1D Antibody [NBP1-82655] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells and islets of Langerhans.
Western Blot: POLR1D Antibody [NBP1-82655] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR1D Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR1D
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
POLR1D Protein (NBP1-82655PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLR1D Antibody

  • AC19
  • DNA-directed RNA polymerase I subunit D
  • DNA-directed RNA polymerases I and III subunit RPAC2
  • FLJ20616
  • hRPA19
  • MGC9850
  • POLR1C
  • polymerase (RNA) I polypeptide D, 16kDa
  • RPA16RNA polymerase I 16 kDa subunit
  • RPA9
  • RPAC2RNA polymerases I and III subunit AC2
  • RPC16
  • RPO1-3
  • TCS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80817
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93617
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-86908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-53092
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67698
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93863
Species: Mu, Rt
Applications: IHC, IHC-P
NBP1-86780
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83204
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87113
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB300-268
Species: Bv, Ce, Hu, I, Mu, Pl
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00482
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32716
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB200-598
Species: Hu, Mu, Pm(-), Ye
Applications: ChIP, CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IP, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for POLR1D Antibody (NBP1-82655) (0)

There are no publications for POLR1D Antibody (NBP1-82655).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1D Antibody (NBP1-82655) (0)

There are no reviews for POLR1D Antibody (NBP1-82655). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR1D Antibody (NBP1-82655) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR1D Products

Bioinformatics Tool for POLR1D Antibody (NBP1-82655)

Discover related pathways, diseases and genes to POLR1D Antibody (NBP1-82655). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1D Antibody (NBP1-82655)

Discover more about diseases related to POLR1D Antibody (NBP1-82655).
 

Pathways for POLR1D Antibody (NBP1-82655)

View related products by pathway.

Blogs on POLR1D

There are no specific blogs for POLR1D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR1D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1D