POLR2F Antibody

Images

 
Western Blot: POLR2F Antibody [NBP1-81714] - Analysis in control (vector only transfected HEK293T lysate) and POLR2F over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: POLR2F Antibody [NBP1-81714] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: POLR2F Antibody [NBP1-81714] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells, cells in molecular layer and cells in granular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR2F Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELII
Specificity
Specificity of human POLR2F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR2F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLR2F Antibody

  • DNA-directed RNA polymerase II subunit F
  • DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide
  • HRBP14.4
  • II, and III subunit RPABC2
  • polymerase (RNA) II (DNA directed) polypeptide F
  • RNA Polymerase II subunit 14.4 kD
  • RNA polymerases I, II, and III subunit ABC2
  • RPB6 homolog
  • RPB6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55778
Species: Hu
Applications: ICC/IF
NBP1-76929
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31611
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-81714
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for POLR2F Antibody (NBP1-81714) (0)

There are no publications for POLR2F Antibody (NBP1-81714).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2F Antibody (NBP1-81714) (0)

There are no reviews for POLR2F Antibody (NBP1-81714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLR2F Antibody (NBP1-81714) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POLR2F Products

Bioinformatics Tool for POLR2F Antibody (NBP1-81714)

Discover related pathways, diseases and genes to POLR2F Antibody (NBP1-81714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2F Antibody (NBP1-81714)

Discover more about diseases related to POLR2F Antibody (NBP1-81714).
 

Pathways for POLR2F Antibody (NBP1-81714)

View related products by pathway.

Research Areas for POLR2F Antibody (NBP1-81714)

Find related products by research area.

Blogs on POLR2F

There are no specific blogs for POLR2F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR2F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2F