POLR2K Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: POLR2K Antibody [NBP2-55856] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR2K Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
Specificity
Specificity of human POLR2K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR2K
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for POLR2K Antibody

  • ABC10-alpha
  • DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide
  • DNA-directed RNA polymerase II subunit K
  • DNA-directed RNA polymerases I, II, and III subunit RPABC4
  • hRPB7.0
  • hsRPB10a
  • polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa
  • RNA polymerase II 7.0 kDa subunit
  • RNA polymerases I, II, and III subunit ABC4
  • RPABC4
  • RPB10alphapolymerase (RNA) II (DNA directed) polypeptide K (7.0kD)
  • RPB12
  • RPB7.0

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP1-80817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1805
Species: Hu, Mu, Ye
Applications: WB, IHC, IHC-P, IP
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46733
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, ChIP, CHIP-SEQ, KD
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56362
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-48706
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for POLR2K Antibody (NBP2-55856) (0)

There are no publications for POLR2K Antibody (NBP2-55856).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2K Antibody (NBP2-55856) (0)

There are no reviews for POLR2K Antibody (NBP2-55856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for POLR2K Antibody (NBP2-55856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional POLR2K Products

Bioinformatics Tool for POLR2K Antibody (NBP2-55856)

Discover related pathways, diseases and genes to POLR2K Antibody (NBP2-55856). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2K Antibody (NBP2-55856)

Discover more about diseases related to POLR2K Antibody (NBP2-55856).
 

Pathways for POLR2K Antibody (NBP2-55856)

View related products by pathway.

Research Areas for POLR2K Antibody (NBP2-55856)

Find related products by research area.

Blogs on POLR2K

There are no specific blogs for POLR2K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR2K Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2K