POLR1B Antibody

Images

 
Western Blot: POLR1B Antibody [NBP1-53191] - Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLR1B Antibody Summary

Immunogen
Synthetic peptides corresponding to POLR1B (polymerase (RNA) I polypeptide B, 128kDa) The peptide sequence was selected from the middle region of POLR1B)(50ug). Peptide sequence SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLR1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against POLR1B and was validated on Western blot.
Theoretical MW
128 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for POLR1B Antibody

  • DNA-directed RNA polymerase I 135 kDa polypeptide
  • DNA-directed RNA polymerase I 135kDa polypeptide
  • DNA-directed RNA polymerase I subunit RPA2
  • EC 2.7.7.6
  • FLJ10816
  • FLJ21921
  • MGC131780
  • polymerase (RNA) I polypeptide B, 128kDa
  • RNA polymerase I subunit 2
  • RPA116
  • RPA135
  • RPA2
  • Rpo1-2

Background

Eukaryotic RNA polymerase I (pol I) is responsible for the transcription of ribosomal RNA (rRNA) genes and production of rRNA, the primary component of ribosomes. Pol I is a multisubunit enzyme composed of 6 to 14 polypeptides, depending on the species. Most of the mass of the pol I complex derives from the 2 largest subunits, Rpa1 and Rpa2 in yeast. POLR1B is homologous to Rpa2 (Seither and Grummt, 1996 [PubMed 8921381]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PLA
NBP2-32016
Species: Hu
Applications: IHC, IHC-P
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB100-159
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP

Publications for POLR1B Antibody (NBP1-53191) (0)

There are no publications for POLR1B Antibody (NBP1-53191).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR1B Antibody (NBP1-53191) (0)

There are no reviews for POLR1B Antibody (NBP1-53191). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR1B Antibody (NBP1-53191) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR1B Products

Bioinformatics Tool for POLR1B Antibody (NBP1-53191)

Discover related pathways, diseases and genes to POLR1B Antibody (NBP1-53191). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR1B Antibody (NBP1-53191)

Discover more about diseases related to POLR1B Antibody (NBP1-53191).
 

Pathways for POLR1B Antibody (NBP1-53191)

View related products by pathway.

Blogs on POLR1B

There are no specific blogs for POLR1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR1B
Uniprot