POLG2 Antibody

Images

 
Western Blot: POLG2 Antibody [NBP1-83227] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: POLG2 Antibody [NBP1-83227] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu(-)Species Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POLG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
POLG2 Protein (NBP1-83227PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POLG2 Antibody

  • DNA polymerase gamma accessory 55 kDa subunit
  • DNA polymerase subunit gamma-2, mitochondrial
  • EC 2.7.7.7
  • HP55
  • Mitochondrial DNA polymerase accessory subunit
  • mitochondrial DNA polymerase subunit gamma-2
  • mitochondrial DNA polymerase, accessory subunit
  • MtPolB
  • MTPOLBPOLG-BETA
  • p55
  • PEOA4
  • POLB
  • POLGB
  • PolG-beta
  • polymerase (DNA directed), gamma 2, accessory subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49833
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P

Publications for POLG2 Antibody (NBP1-83227) (0)

There are no publications for POLG2 Antibody (NBP1-83227).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLG2 Antibody (NBP1-83227) (0)

There are no reviews for POLG2 Antibody (NBP1-83227). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLG2 Antibody (NBP1-83227) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLG2 Products

Bioinformatics Tool for POLG2 Antibody (NBP1-83227)

Discover related pathways, diseases and genes to POLG2 Antibody (NBP1-83227). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLG2 Antibody (NBP1-83227)

Discover more about diseases related to POLG2 Antibody (NBP1-83227).
 

Pathways for POLG2 Antibody (NBP1-83227)

View related products by pathway.

Blogs on POLG2

There are no specific blogs for POLG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLG2