POLDIP1 Antibody


Western Blot: POLDIP1 Antibody [NBP2-14147] - Analysis in control (vector only transfected HEK293T lysate) and KCTD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: POLDIP1 Antibody [NBP2-14147] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining in human testis and pancreas tissues using anti-KCTD13 antibody. Corresponding KCTD13 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

POLDIP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD
Specificity of human POLDIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
POLDIP1 Protein (NBP2-14147PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for POLDIP1 Antibody

  • BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
  • BTB/POZ domain-containing protein KCTD13
  • hBACURD1
  • POLDIP1TNFAIP1-like protein
  • Polymerase delta-interacting protein 1
  • potassium channel tetramerisation domain containing 13


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for POLDIP1 Antibody (NBP2-14147) (0)

There are no publications for POLDIP1 Antibody (NBP2-14147).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLDIP1 Antibody (NBP2-14147) (0)

There are no reviews for POLDIP1 Antibody (NBP2-14147). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for POLDIP1 Antibody (NBP2-14147) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional POLDIP1 Products

Bioinformatics Tool for POLDIP1 Antibody (NBP2-14147)

Discover related pathways, diseases and genes to POLDIP1 Antibody (NBP2-14147). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLDIP1 Antibody (NBP2-14147)

Discover more about diseases related to POLDIP1 Antibody (NBP2-14147).

Pathways for POLDIP1 Antibody (NBP2-14147)

View related products by pathway.

PTMs for POLDIP1 Antibody (NBP2-14147)

Learn more about PTMs related to POLDIP1 Antibody (NBP2-14147).

Blogs on POLDIP1

There are no specific blogs for POLDIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our POLDIP1 Antibody and receive a gift card or discount.


Gene Symbol KCTD13