POLDIP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining in human testis and skeletal muscle tissues.. Corresponding KCTD13 RNA-seq data are presented for the same tissues.

Western Blot: POLDIP1 Antibody [NBP2-14147] - Analysis in control (vector only transfected HEK293T lysate) and KCTD13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: POLDIP1 Antibody [NBP2-14147] - Staining of human cell line A-431 shows localization to nucleus & nuclear bodies. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human skeletal muscle shows very weak positivity in myocytes.

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human prostate shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP2-14147] - Staining of human testis shows moderate to strong nuclear positivity in Leydig cells and cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

POLDIP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGEDEENREHRVRRIHVRRHITHDERPHGQQIVFKD
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCTD13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  POLDIP1 Protein (NBP2-14147PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for POLDIP1 Antibody - BSA Free

• BACURD1
• BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
• BTB/POZ domain-containing protein KCTD13
• hBACURD1
• PDIP1FKSG86
• POLDIP1TNFAIP1-like protein
• Polymerase delta-interacting protein 1
• potassium channel tetramerisation domain containing 13

Background

KCTD13 is a gene that codes for a widely expressed protein that functions as a substrate-specific adapter that is involved of the maintenance of the cytoskeleton structure via the regulation of the actin cytoskeleton and cell migrationt that is 329 amino acids long and weighs approximately 36 kDa. Studies are being conducted on diseases and disorders relating to this gene, including microephaly. KCTD13 has also been shown to have interactions with KAT7, LNX1, ZMYND19, ARMC7, and VTA1 in pathways such as the cholera infection, hepatic ABC transporter, PKA signaling, and sweet taste signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCTD13