POGZ Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

POGZ Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POGZ.
  
  

  Source: E. coli

  Amino Acid Sequence: GEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLH

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: POGZ
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83005.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POGZ Recombinant Protein Antigen

• KIAA0461ZNF635
• pogo transposable element with ZNF domain
• putative protein product of Nbla00003
• SUHW5MGC71543
• Suppressor of hairy wing homolog 5
• Zinc finger protein 280E
• Zinc finger protein 635
• ZNF280EZNF635m

Background

Pogz is a zinc-finger protein containing at least 8 C2H2 zinc fingers, a CENP-B (centromere protein-B) domain, and a DDE domain found in the bacterial transposase/retroviral integrase family. Members of this family of integrases share structural homologies and show similar catalytic activity to the RAG1 and RAG2 proteins that initiate V(D)J recombination in lymphoid progenitors. Mouse Pogz has a human homolog with a base pair similarity of 90% and amino acid similarity of 93% for the full length protein. In humans at least 3 variants have been predicted and they are all similar at the Nterminus. A number of expressed sequence tags (ESTs) cloned from murine undifferentiated ES cells and Lin-/c-Kit+/Sca-1+ hematopoietic stem cell cDNA libraries correspond to the Pogz gene, further underlining an important function for this gene in stem cells. In mice, deletion of the gene in all tissues early in embryogenesis has been shown to be lethal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: POGZ