POGZ Recombinant Protein Antigen

Images

 
There are currently no images for POGZ Protein (NBP1-83005PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POGZ Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POGZ.

Source: E. coli

Amino Acid Sequence: GEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSILLEAKESGYSDDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POGZ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83005.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POGZ Recombinant Protein Antigen

  • KIAA0461ZNF635
  • pogo transposable element with ZNF domain
  • putative protein product of Nbla00003
  • SUHW5MGC71543
  • Suppressor of hairy wing homolog 5
  • Zinc finger protein 280E
  • Zinc finger protein 635
  • ZNF280EZNF635m

Background

Pogz is a zinc-finger protein containing at least 8 C2H2 zinc fingers, a CENP-B (centromere protein-B) domain, and a DDE domain found in the bacterial transposase/retroviral integrase family. Members of this family of integrases share structural homologies and show similar catalytic activity to the RAG1 and RAG2 proteins that initiate V(D)J recombination in lymphoid progenitors. Mouse Pogz has a human homolog with a base pair similarity of 90% and amino acid similarity of 93% for the full length protein. In humans at least 3 variants have been predicted and they are all similar at the Nterminus. A number of expressed sequence tags (ESTs) cloned from murine undifferentiated ES cells and Lin-/c-Kit+/Sca-1+ hematopoietic stem cell cDNA libraries correspond to the Pogz gene, further underlining an important function for this gene in stem cells. In mice, deletion of the gene in all tissues early in embryogenesis has been shown to be lethal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3468
Species: Hu
Applications: ICC, KO, Simple Western, WB
NB100-68209
Species: Hu
Applications: IP, KD, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NB100-74543
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00007071-M15
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-85982
Species: Hu
Applications: WB
AF1138
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
DRT200
Species: Hu
Applications: ELISA
H00003059-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, PLA, S-ELISA, WB
8415-A2
Species: Mu
Applications: BA
NBP1-87214
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-52420
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC,  IHC-P, WB
DY8198-05
Species: Hu
Applications: ELISA
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-18910
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
MAB224
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
NBP1-83005PEP
Species: Hu
Applications: AC

Publications for POGZ Protein (NBP1-83005PEP) (0)

There are no publications for POGZ Protein (NBP1-83005PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POGZ Protein (NBP1-83005PEP) (0)

There are no reviews for POGZ Protein (NBP1-83005PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POGZ Protein (NBP1-83005PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POGZ Products

Array NBP1-83005PEP

Blogs on POGZ

There are no specific blogs for POGZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POGZ Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POGZ