Podocin/NPHS2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Analysis in human kidney and tonsil tissues using NBP2-33570 antibody. Corresponding NPHS2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human Placenta shows no positivity in trophoblastic cells as expected.

Immunohistochemistry-Paraffin: Podocin/NPHS2 Antibody [NBP2-33570] - Staining of human Tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Podocin/NPHS2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Podocin/NPHS2 Antibody - BSA Free (NBP2-33570) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPHS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Podocin/NPHS2 Recombinant Protein Antigen (NBP2-33570PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Podocin/NPHS2 Antibody - BSA Free

• Nephrosis 2
• nephrosis 2, idiopathic, steroid-resistant (podocin)
• NPHS2
• PDCN
• PDCNSRN1podocin
• Podocin
• SRN1

Background

NPHS2 encodes the glomerular protein podocin which plays a role in the regulation of glomerular permeability, and acts as a linker between the plasma membrane and the cytoskeleton. Defects in this gene are the cause of autosomal recessive steroid-resistant nephrotic syndrome (SRN). SRN is characterized by onset between three months and five years, resistance to steroid therapy and rapid progression to end-stage renal disease. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPHS2
• Uniprot:
  • Q9NP85()