PNPO Antibody

Images

 
Western Blot: PNPO Antibody [NBP1-87302] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: PNPO Antibody [NBP1-87302] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87302] - Staining of human kidney shows strong positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNPO Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PNPO Protein (NBP1-87302PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNPO Antibody

  • EC 1.4.3.5
  • FLJ10535
  • PDXPO
  • pyridoxal 5'-phosphate synthase
  • pyridoxamine 5'-phosphate oxidase
  • Pyridoxamine-phosphate oxidase
  • pyridoxine 5'-phosphate oxidase
  • pyridoxine-5'-phosphate oxidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27461
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87781
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00821
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
AF6486
Species: Hu
Applications: WB, Simple Western
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF6014
Species: Hu, Mu, Rt
Applications: WB
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-29940
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
H00008833-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC

Publications for PNPO Antibody (NBP1-87302) (0)

There are no publications for PNPO Antibody (NBP1-87302).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNPO Antibody (NBP1-87302) (0)

There are no reviews for PNPO Antibody (NBP1-87302). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PNPO Antibody (NBP1-87302) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNPO Products

Bioinformatics Tool for PNPO Antibody (NBP1-87302)

Discover related pathways, diseases and genes to PNPO Antibody (NBP1-87302). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPO Antibody (NBP1-87302)

Discover more about diseases related to PNPO Antibody (NBP1-87302).
 

Pathways for PNPO Antibody (NBP1-87302)

View related products by pathway.

PTMs for PNPO Antibody (NBP1-87302)

Learn more about PTMs related to PNPO Antibody (NBP1-87302).

Blogs on PNPO

There are no specific blogs for PNPO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNPO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPO