Western Blot: PLVAP Antibody [NBP1-83911] - Cell lysate from Human Retinal Microvascular Endothelial Cells (HRMECs). PLVAP antibody at a dilution of (1:1000) and overnight incubation at 4C. Left = untreated cells and ...read more
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Human kidney. Heat mediated antigen retrieval in citrate buffer (pH 6) at 95C for 20 minutes. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human duodenum shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human fallopian tube shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: PLVAP Antibody [NBP1-83911] - Staining of human tonsil shows strong membranous positivity in endothelial cells.
Novus Biologicals Rabbit PLVAP Antibody - BSA Free (NBP1-83911) is a polyclonal antibody validated for use in IHC and WB. Anti-PLVAP Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLVAP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for PLVAP Antibody - BSA Free
FELS
FELSfenestrated-endothelial linked structure protein; PV-1 protein
Fenestrated endothelial-linked structure protein
gp68
plasmalemma vesicle associated protein
PLVAP
PV1
PV-1
PV1Plasmalemma vesicle protein 1
PV-1plasmalemma vesicle-associated protein
Background
PLVAP (Plasmalemma vesicle associated protein) is a membrane associated protein of caveolae and is found in fenestral and stomatal diaphragms in fenestrated endothelia and transendothelial channels. Normally in skeletal and cardiac muscle, PLVAP expression is limited to small arterioles and venules; however, under conditions of inflammation, it can be induced on previously non expressing vessels in cardiac muscle. In the central nervous system (CNS), the panendothelial cell antigen expression is developmentally regulated. During embryonic development, the antigen is found on brain vasculature up to day 16 of gestation, after which it disappears. The cessation of PLVAP expression in the CNS may be associated with the establishment of the blood brain barrier, which begins on day 16 of gestation. In the adult mouse, inflammation in the CNS can lead to re expression of the panendothelial cell antigen. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Cell lysate from Human Retinal Microvascular Endothelial Cells (HRMECs) was prepared and loaded onto Mini-protean TGX gel followed by western blot with NBP1-83911 (PLVAP antibody) at a dilution of (1:1000) and incubated over night at 4 C. Left = untreated cells and right = 24 hr VEGFA treatment. Green band = PLVAP and Red band = Actin
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.