PLEKHA7 Antibody

Images

 
Western Blot: PLEKHA7 Antibody [NBP1-79526] - HepG2 cell lysate 0.2-1 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHA7 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human PLEKHA7The immunogen for this antibody is PLEKHA7 (NP_778228). Peptide sequence PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PLEKHA7 and was validated on Western blot.
Theoretical MW
127 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLEKHA7 Antibody

  • DKFZp686M22243
  • PH domain-containing family A member 7
  • pleckstrin homology domain containing, family A member 2
  • pleckstrin homology domain containing, family A member 7
  • pleckstrin homology domain-containing family A member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37959
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86021
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-20229
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, ICC
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97753
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP1-79526
Species: Hu
Applications: WB

Publications for PLEKHA7 Antibody (NBP1-79526) (0)

There are no publications for PLEKHA7 Antibody (NBP1-79526).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHA7 Antibody (NBP1-79526) (0)

There are no reviews for PLEKHA7 Antibody (NBP1-79526). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLEKHA7 Antibody (NBP1-79526) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PLEKHA7 Antibody (NBP1-79526)

Discover related pathways, diseases and genes to PLEKHA7 Antibody (NBP1-79526). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHA7 Antibody (NBP1-79526)

Discover more about diseases related to PLEKHA7 Antibody (NBP1-79526).
 

Pathways for PLEKHA7 Antibody (NBP1-79526)

View related products by pathway.

Blogs on PLEKHA7

There are no specific blogs for PLEKHA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHA7
Entrez
Uniprot