Reactivity | Hu, MuSpecies Glossary |
Applications | WB, ELISA |
Clone | 6C4 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
Specificity | CACNB2 - calcium channel, voltage-dependent, beta 2 subunit |
Isotype | IgG2b Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | CACNB2 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Anmol Kumar |
WB | Human | 06/06/2018 |
Summary
|
||||||||
![]() Enlarge |
reviewed by:
Abby Sewell |
WB | Human | 12/01/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for CACNB2 Antibody (H00000783-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Anmol Kumar 06/06/2018 |
||
Application: | WB | |
Species: | Human |
Abby Sewell 12/01/2014 |
||
Application: | WB | |
Species: | Human |