Home » CACNB2 » CACNB2 Antibodies » CACNB2 Antibody (6C4)

CACNB2 Antibody (6C4)

 (4 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - analysis of CACNB2 in HEK293 and CHO whole cell lysates using anti-CACNB2 antibody. Image from verified customer review.
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in Hela S3 NE (Cat # L013V3).
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Primary antibody dilution-1:1000 in blocking buffer, 5% Milk in TBS-0.05% Tween for 2 hours at RT. Blocking Overnightat +4 degreeC 2 Hours at RT. Secondary ...read more
ELISA: CACNB2 Antibody (6C4) [H00000783-M05] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
6C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CACNB2 Antibody (6C4) Summary

Immunogen
CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Specificity
CACNB2 - calcium channel, voltage-dependent, beta 2 subunit
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CACNB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Reviewed Applications
Read 2 Reviews rated 4.5
using
H00000783-M05 in the following applications:
Publications
Read Publications using
H00000783-M05 in the following applications:

  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CACNB2 Antibody (6C4)

  • CAB2
  • CACNB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • calcium channel, voltage-dependent, beta 2 subunit
  • CAVB2
  • FLJ23743
  • Lambert-Eaton myasthenic syndrome antigen B
  • myasthenic (Lambert-Eaton) syndrome antigen B
  • MYSB
  • voltage-dependent L-type calcium channel subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI/CF
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI/CF) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(18 Publications)
Species: Hu
Applications: BA
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody (S57) [NBP1-22439] - Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Cav1.2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cell Membrane, Membrane, Cytoplasm, Nucleoplasm. Magnification: 60X. (A) Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain.
Western Blot: Cav1.2 Antibody (S57) [NBP1-22439] - Western Blot analysis of Hamster T-CHO cell lysate showing detection of CaV1.2 Calcium Channel protein using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57 (NBP1-22439). Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody (NBP1-22439) at 1:1000.
Immunohistochemistry: Cav1.2 Antibody (S57) [NBP1-22439] - Immunohistochemistry analysis using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57 (NBP1-22439). Tissue: hippocampus. Species: Human. Fixation: 10% formalin. Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody (NBP1-22439) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NPDC-1 Antibody
AF5489
Western blot shows lysates of human brain tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NPDC‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5489) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for NPDC‑1 at approximately 40 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
NPDC‑1 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Sheep Anti-Human NPDC‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5489) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and synaptic vesicles of neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
TRNT1 Antibody
NBP1-86589
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
(6 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
STARD3 Antibody
NBP2-94159
Western Blot: STARD3 Antibody [NBP2-94159] - Analysis of extracts of various cell lines, using STARD3 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 15s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
integrin beta 4
binding protein Antib ...
NBP2-13954
Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining in human esophagus and skeletal muscle tissues using anti-EIF6 antibody. Corresponding EIF6 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human rectum and pancreas tissues. Corresponding CA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human duodenum shows no positivity in glandular cells as expected.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Nav1.5 Antibody
(4G8:1G7)
NB110-61010
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on MG-63 cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on U2OS cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Immunocytochemistry/Immunofluorescence: Nav1.5 Antibody (4G8-1G7) [NB110-61010] - Figure A: Plasma membrane localisation of Nav1.5 identified by 4G8:1G7 detected by anti-mouse Alexa Fluor-488 conjugated antibody; Figure B, DAP1 co-staining of cell nuclei
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, RIA, WB
CACNB4 Antibody
NBP1-83984
Western Blot: CACNB4 Antibody [NBP1-83984] - Analysis in control (vector only transfected HEK293T lysate) and CACNB4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CACNB4 Antibody [NBP1-83984] - Staining of human cerebellum shows strong cytoplasmic positivity in most cells.
Species: Hu
Applications: IHC, IHC-P, WB
CACNA1A Antibody
NBP3-17155
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP3-17155] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Species: Hu
Applications: IHC, IHC-P
CACNB1 Antibody
NBP2-76915
Western Blot: CACNB1 Antibody [NBP2-76915] - Analysis of CACNB1 on SH-SY-5Y cell lysate using anti-CACNB1 antibody at 1/1,000 dilution. Lane1: SH-SY-5Y cell lysate Lane2: SH-SY-5Y cell lysate with immunizaiton peptide.
Immunohistochemistry-Paraffin: CACNB1 Antibody [NBP2-76915] - Analysis of rat heart tissue using anti-CACNB1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: CACNB1 Antibody [NBP2-76915] - Analysis of human fetal skeletal muscle tissue using anti-CACNB1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CACNA2D1 Antibody
(20A)
NB120-2864
Western Blot: CACNA2D1 Antibody (20A) [NB120-2864] - Primary antibody dilution- 1:1000 for 2 Hours at RT, in blocking buffer, 5% Milk in TBS-0.05% Tween : Blocking Overnight at +4 degree C. Secondary antibody : 1:2000 in blocking buffer, 1 hour at RT. Image from verified customer review.
Immunohistochemistry-Paraffin: CACNA2D1 Antibody (20A) [NB120-2864] - Normal biopsies of deparaffinized human skeletal muscle tissue.
Immunohistochemistry-Paraffin: CACNA2D1 Antibody (20A) [NB120-2864] - Normal biopsies of deparaffinized mouse skeletal muscle tissue.
(1 Review)
(8 Publications)
Species: Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
QRSL Antibody
NBP1-87992
Western Blot: QRSL Antibody [NBP1-87992] - Analysis using Anti-QRSL1 antibody NBP1-87992 (A) shows similar pattern to independent antibody NBP1-87991 (B).
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: QRSL Antibody [NBP1-87992] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Cav1.3 Antibody
(S48)
NBP2-12893
Immunohistochemistry: Cav1.3 Antibody (S48) [NBP2-12893] - IHC analysis of Cav1.3 tested on human hippocampus lysates. Courtesy of Dr. Turksen, Ottawa Hospital Research Institute, Canada.
Immunohistochemistry: Cav1.3 Antibody (S48) [NBP2-12893] - Immunohistochemistry analysis using Mouse Anti-CaV1.3 Calcium Channel Monoclonal Antibody, Clone S48 (NBP2-12893). Tissue: backskin. Species: Mouse. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-CaV1.3 Calcium Channel Monoclonal Antibody (NBP2-12893) at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
Immunohistochemistry: Cav1.3 Antibody (S48) [NBP2-12893] - Immunohistochemistry analysis using Mouse Anti-CaV1.3 Calcium Channel Monoclonal Antibody, Clone S48 (NBP2-12893). Tissue: hippocampus. Species: Human. Fixation: Bouin's Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-CaV1.3 Calcium Channel Monoclonal Antibody (NBP2-12893) at 1:1000 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
DET1 Antibody
NBP2-13914
Immunohistochemistry-Paraffin: DET1 Antibody [NBP2-13914] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/Immunofluorescence: DET1 Antibody [NBP2-13914] - Staining of human cell line A549 shows localization to nucleoplasm & microtubules. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SCN3B Antibody
(S396-29)
NBP2-59318
Immunocytochemistry/Immunofluorescence: SCN3B Antibody (S396-29) [NBP2-59318] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Nav beta 3 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Cell Membrane, Nucleus. Magnification: 60X.
Western Blot: SCN3B Antibody (S396-29) [NBP2-59318] - Western Blot analysis of Mouse Brain showing detection of ~40 kDa Nav Beta 3 protein using Mouse Anti-Nav Beta 3 Monoclonal Antibody, Clone S396-29 (NBP2-59318). Lane 1: MW Ladder. Lane 2: Mouse Brain. Load: 20 ug. Primary Antibody: Mouse Anti-Nav Beta 3 Monoclonal Antibody (NBP2-59318) at 1:1000 for 16 hours at 4C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Predicted/Observed Size: ~40 kDa.
Immunocytochemistry/Immunofluorescence: SCN3B Antibody (S396-29) [NBP2-59318] - Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Nav beta3 Monoclonal Antibody, Clone S396-29 (NBP2-59318). Tissue: Neuroblastoma cells (SH-SY5Y). Species: Human. Fixation: 4% PFA for 15 min. Primary Antibody: Mouse Anti-Nav beta3 Monoclonal Antibody (NBP2-59318) at 1:200 for overnight at 4C with slow rocking. Secondary Antibody: AlexaFluor 488 at 1:1000 for 1 hour at RT. Counterstain: Phalloidin-iFluor 647 (red) F-Actin stain; Hoechst (blue) nuclear stain at 1:800, 1.6mM for 20 min at RT. (A) Hoechst (blue) nuclear stain. (B) Phalloidin-iFluor 647 (red) F-Actin stain. (C) Nav beta3 Antibody (D) Composite.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, Simple Western, WB
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in 13 year old testis. Immunoexpression in Leydig cell. Image from a verified customer review.
Immunohistochemistry: Cytochrome P450 17A1 Antibody (OTI3F11) [NBP2-01151] - Staining in macaque Leydig cells. Image from a verified customer review.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Hela cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(4 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Analysis of GNAI1 expression in transfected 293T cell line by GNAI1 monoclonal antibody (M01), clone 2B8-2A5.Lane 1: GNAI1 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Analysis of monoclonal antibody to GNAI1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Sandwich ELISA: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Detection limit for recombinant GST tagged GNAI1 is approximately 1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(10 Reviews)
(52 Publications)
Species: Hu
Applications: BA
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for CACNB2 Antibody (H00000783-M05)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CACNB2 Antibody (H00000783-M05) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using H00000783-M05:
Filter by Applications
Western Blot
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot CACNB2 H00000783-M05
Enlarge 		5
reviewed by:
Verified Customer
 Western Blot Human 06/06/2018
View

Summary

ApplicationWestern Blot
Sample TestedARPE19 Cell lysate
SpeciesHuman
Lot07075-6C4
Western Blot CACNB2 H00000783-M05
Enlarge 		4
reviewed by:
Verified Customer
 Western Blot Human 12/01/2014
View

Summary

ApplicationWestern Blot
Sample TestedHEK293 and CHO Whole cell lysates, CHO stably transfected with CACNA1C, CACNB2, and CACNA2D (ChanTest, CT-6004)
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNB2 Antibody (H00000783-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNB2 Products

Bioinformatics Tool for CACNB2 Antibody (H00000783-M05)

Discover related pathways, diseases and genes to CACNB2 Antibody (H00000783-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB2 Antibody (H00000783-M05)

Discover more about diseases related to CACNB2 Antibody (H00000783-M05).
 

Pathways for CACNB2 Antibody (H00000783-M05)

View related products by pathway.

PTMs for CACNB2 Antibody (H00000783-M05)

Learn more about PTMs related to CACNB2 Antibody (H00000783-M05).
 

Research Areas for CACNB2 Antibody (H00000783-M05)

Find related products by research area.

Blogs on CACNB2

There are no specific blogs for CACNB2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Western Blot CACNB2 H00000783-M05
Enlarge
 Verified Customer
06/06/2018
Application: Western Blot
Species: Human
read this review
Western Blot CACNB2 H00000783-M05
Enlarge
 Verified Customer
12/01/2014
Application: Western Blot
Species: Human
read this review

Bioinformatics

Gene Symbol CACNB2
Entrez
OMIM
Uniprot