Reactivity | Hu, MuSpecies Glossary |
Applications | WB, ELISA |
Clone | 6C4 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | CACNB2 (NP_963890, 213 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ |
Specificity | CACNB2 - calcium channel, voltage-dependent, beta 2 subunit |
Isotype | IgG2b Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | CACNB2 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publications using H00000783-M05 | Applications | Species |
---|---|---|
Horiuchi-Hirose M, Kashihara T, Nakada T et al. Decrease in the density of t-tubular L-type Ca2+ channel currents in failing ventricular myocytes. Am J Physiol Heart Circ Physiol. 2010 Dec 30 [PMID: 21193586] | ||
Teng J, Iida K, Ito M et al. Role of glycine residues highly conserved in the S2-S3 linkers of domains I and 2 of voltage-gated calcium channel alpha1 subunits. Biochim Biophys Acta 2010 Jan 04 (WB, Human) | WB | Human |
Vuori N, Sandholm N, Kumar A et al. CACNB2 is a Novel Susceptibility Gene for Diabetic Retinopathy in Type 1 Diabetes Diabetes Aug 22 2019 [PMID: 31439644] | ||
Teng J, Iida K, Ito M et al. Role of glycine residues highly conserved in the S2. Biochim Biophys Acta1798(5):966-74. 2010 [PMID: 20067760] |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
Western Blot | Human | 06/06/2018 |
Summary
|
||||||||
![]() Enlarge |
reviewed by:
Verified Customer |
Western Blot | Human | 12/01/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for CACNB2 Antibody (H00000783-M05)Discover more about diseases related to CACNB2 Antibody (H00000783-M05).
| Pathways for CACNB2 Antibody (H00000783-M05)View related products by pathway.
|
PTMs for CACNB2 Antibody (H00000783-M05)Learn more about PTMs related to CACNB2 Antibody (H00000783-M05).
| Research Areas for CACNB2 Antibody (H00000783-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 06/06/2018 |
||
Application: | Western Blot | |
Species: | Human |
Verified Customer 12/01/2014 |
||
Application: | Western Blot | |
Species: | Human |