Home » CACNB2 » CACNB2 Antibodies » CACNB2 Antibody (6C4)

CACNB2 Antibody (6C4)

 (3 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Primary antibody dilution-1:1000 in blocking buffer, 5% Milk in TBS-0.05% Tween for 2 hours at RT. Blocking Overnightat +4 degreeC 2 Hours at RT. Secondary antibody: 1:2000 in blocking buffer, 1 hourat RT. Image from verified customer review.
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Primary antibody dilution-1:1000 in blocking buffer, 5% Milk in TBS-0.05% Tween for 2 hours at RT. Blocking Overnightat +4 degreeC 2 Hours at RT. Secondary ...read more
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - analysis of CACNB2 in HEK293 and CHO whole cell lysates using anti-CACNB2 antibody. Image from verified customer review.
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in Hela S3 NE (Cat # L013V3).
ELISA: CACNB2 Antibody (6C4) [H00000783-M05] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
6C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CACNB2 Antibody (6C4) Summary

Immunogen
CACNB2 (NP_963890 213 a.a. - 301 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Specificity
CACNB2 - calcium channel, voltage-dependent, beta 2 subunit
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CACNB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Reviewed Applications
Read 2 Reviews rated 4.5
using
H00000783-M05 in the following applications:
Publications
Read Publications using
H00000783-M05 in the following applications:

  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CACNB2 Antibody (6C4)

  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • calcium channel, voltage-dependent, beta 2 subunit
  • CAVB2
  • FLJ23743
  • Lambert-Eaton myasthenic syndrome antigen B
  • myasthenic (Lambert-Eaton) syndrome antigen B
  • MYSB
  • voltage-dependent L-type calcium channel subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

LIGHT/TNFSF14
[Unconjugated]
664-LI
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(12 Publications)
Species: Hu
Cav1.2 Antibody
(S57-46)
NBP1-22439
Western Blot: Cav1.2 Antibody (S57-46) [NBP1-22439] - analysis of Hamster T-CHO cell lysate showing detection of CaV1.2 Calcium Channel protein using Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody, Clone S57-46. Primary Antibody: Mouse Anti-CaV1.2 Calcium Channel Monoclonal Antibody at 1:1000.
Immunocytochemistry/Immunofluorescence: Cav1.2 Antibody (S57-46) [NBP1-22439] - Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Cav1.2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cell Membrane, Membrane, Cytoplasm, Nucleoplasm. Magnification: 60X. (A) Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain.
Immunohistochemistry: Cav1.2 Antibody (S57-46) [NBP1-22439] - Human hippocampus tissues. Courtesy of Dr. Turksen, Ottawa Hospital Research Institute, Canada.
(1 Publication)
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NPDC-1 Antibody
AF5489
Western blot shows lysates of human brain tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human NPDC‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5489) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for NPDC‑1 at approximately 40 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
NPDC‑1 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Sheep Anti-Human NPDC‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5489) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and synaptic vesicles of neuronal processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
TRNT1 Antibody
NBP1-86589
Western Blot: TRNT1 Antibody [NBP1-86589] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TRNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: TRNT1 Antibody [NBP1-86589] - Staining of human cell line A-431 shows positivity in mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-86589] - Staining of human stomach shows moderate cytoplasmic and nuclear positivity in glandular cells.
(2 Publications)
Species: Hu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
Recombinant Human
STARD3 Protein
H00010948-P01
SDS-Page: Recombinant Human STARD3 Protein [H00010948-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
integrin beta 4
binding protein Antib ...
NBP2-13954
Western Blot: integrin beta 4 binding protein Antibody [NBP2-13954] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: integrin beta 4 binding protein Antibody [NBP2-13954] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: integrin beta 4 binding protein Antibody [NBP2-13954] - Staining of human skeletal muscle shows low expression as expected.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining in human rectum and pancreas tissues using anti-CA1 antibody. Corresponding CA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human pancreas shows low expression as expected.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Nav1.5 Antibody
(4G8:1G7)
NB110-61010
Immunocytochemistry/Immunofluorescence: Nav1.5 Antibody (4G8-1G7) [NB110-61010] - Figure A: Plasma membrane localisation of Nav1.5 identified by 4G8:1G7 detected by anti-mouse Alexa Fluor-488 conjugated antibody; Figure B, DAP1 co-staining of cell nuclei
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on U2OS cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Flow Cytometry: Nav1.5 Antibody (4G8:1G7) [NB110-61010] - An intracellular stain was performed on MG-63 cells with Nav1.5 Antibody [4G8:1G7] NB110-61010PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
CACNB4 Antibody
NBP1-83984
Western Blot: CACNB4 Antibody [NBP1-83984] - Analysis in control (vector only transfected HEK293T lysate) and CACNB4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: CACNB4 Antibody [NBP1-83984] - Staining of human cerebellum shows strong cytoplasmic positivity in most cells.
Species: Hu
Applications: WB, IHC, IHC-P
CACNA1A Antibody
NBP2-38049
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining in human cerebral cortex and pancreas tissues using anti-CACNA1A antibody. Corresponding CACNA1A RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: CACNA1A Antibody [NBP2-38049] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CACNB1 Antibody
(S7-18)
NBP2-12907
Western Blot: CACNB1 Antibody (S7-18) [NBP2-12907] - analysis of Rat brain membrane lysate showing detection of CACNB1 Calcium Channel protein using Mouse Anti-CACNB1 Calcium Channel Monoclonal Antibody, Clone S7-18. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-CACNB1 Calcium Channel Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: CACNB1 Antibody (S7-18) [NBP2-12907]
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
CACNA2D1 Antibody
(20A)
NB120-2864
Western Blot: CACNA2D1 Antibody (20A) [NB120-2864] - Primary antibody dilution- 1:1000 for 2 Hours at RT, in blocking buffer, 5% Milk in TBS-0.05% Tween : Blocking Overnight at +4 degree C. Secondary antibody : 1:2000 in blocking buffer, 1 hour at RT. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: CACNA2D1 Antibody (20A) [NB120-2864] - Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with a Dihydropyridine Receptor alpha-2 monoclonal antibody at a dilution of 1:100 overnight at 4 C, washed with PBS and incubated with a DyLight-488 conjugated secondary antibody and nuclei with DAPI (blue) is shown.
Immunohistochemistry-Paraffin: CACNA2D1 Antibody (20A) [NB120-2864] - Normal biopsies of deparaffinized mouse skeletal muscle tissue.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
QRSL Antibody
NBP1-87992
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: QRSL Antibody [NBP1-87992] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.
Western Blot: QRSL Antibody [NBP1-87992] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Cav1.3 Antibody
NBP1-86684
Immunocytochemistry/Immunofluorescence: Cav1.3 Antibody [NBP1-86684] - Staining of human cell line CACO-2 shows localization to nuclear membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cav1.3 Antibody [NBP1-86684] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DET1 Antibody
NBP2-13914
Immunocytochemistry/Immunofluorescence: DET1 Antibody [NBP2-13914] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & microtubules.
Immunohistochemistry-Paraffin: DET1 Antibody [NBP2-13914] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SCN3B Antibody
37470002
ELISA: SCN3B Antibody [37470002]
(1 Review)
(2 Publications)
Species: Hu
Applications: WB, ELISA
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Western Blot: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 17A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 17A1.
Immunohistochemistry-Paraffin: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Staining of paraffin-embedded Human tonsil using anti-Cytochrome P450 17A1 mouse monoclonal antibody.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Jurkat cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P
G protein alpha
inhibitor 1 Antibody
NBP1-52926
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:12500 Positive Control: Human brain
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000
Western Blot: G protein alpha inhibitor 1 Antibody [NBP1-52926] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.
(1 Publication)
Species: Hu
Applications: WB
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
Recombinant Human ErbB2/Her2 Fc Chimera (Catalog # 1129-ER) blocks anti-ErbB2 mediated inhibition of the SK‑BR‑3 human breast cancer cell line. The ED50 is 20-80 ng/mL in the presence of 0.6 μg/mL Goat Anti-Human ErbB2/Her2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1129)
(7 Reviews)
(28 Publications)
Species: Hu
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CACNB2 Antibody (H00000783-M05)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 3 of 3.
Publications using H00000783-M05 Applications Species
Horiuchi-Hirose M, Kashihara T, Nakada T et al. Decrease in the density of t-tubular L-type Ca2+ channel currents in failing ventricular myocytes. Am J Physiol Heart Circ Physiol. 2010 Dec 30 [PMID: 21193586]
Teng J, Iida K, Ito M et al. Role of glycine residues highly conserved in the S2-S3 linkers of domains I and 2 of voltage-gated calcium channel alpha1 subunits. Biochim Biophys Acta 2010 Jan 04 (WB, Human) WB Human
Teng J, Iida K, Ito M et al. Role of glycine residues highly conserved in the S2. Biochim Biophys Acta1798(5):966-74. 2010 [PMID: 20067760]

Reviews for CACNB2 Antibody (H00000783-M05) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using H00000783-M05:
Filter by Applications
WB
(2)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot CACNB2 H00000783-M05
Enlarge
reviewed by:
Anmol Kumar
 WB Human 06/06/2018
View

Summary

ApplicationWestern Blot
Sample TestedARPE19 Cell lysate
SpeciesHuman
Lot07075-6C4
Western Blot CACNB2 H00000783-M05
Enlarge
reviewed by:
Abby Sewell
 WB Human 12/01/2014
View

Summary

ApplicationWestern Blot
Sample TestedHEK293 and CHO Whole cell lysates, CHO stably transfected with CACNA1C, CACNB2, and CACNA2D (ChanTest, CT-6004)
SpeciesHuman

Blocking

Blocking Details5% Non-fat Dry Milk in TBST, 1 hour, room temperature

Primary Anitbody

Dilution Ratio1:500, 2 hours at room temperature, 5% Non-fat dry milk in TBST

Secondary Antibody

Secondary DescriptionGoat anti-mouse IgG-HRP
Secondary Manufacturer Cat#sc-2005
Secondary Concentration1:10,000

Details

Detection NotesECL was used to visualize bands. Blots were imaged using a ChemiDoc XRS+ (Bio-Rad), exposure was 10 minutes.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNB2 Antibody (H00000783-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CACNB2 Antibody (H00000783-M05)

Discover related pathways, diseases and genes to CACNB2 Antibody (H00000783-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB2 Antibody (H00000783-M05)

Discover more about diseases related to CACNB2 Antibody (H00000783-M05).
 

Pathways for CACNB2 Antibody (H00000783-M05)

View related products by pathway.

PTMs for CACNB2 Antibody (H00000783-M05)

Learn more about PTMs related to CACNB2 Antibody (H00000783-M05).

Blogs on CACNB2

There are no specific blogs for CACNB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Western Blot CACNB2 H00000783-M05
Enlarge
 Anmol Kumar
06/06/2018
Application: WB
Species: Human
read this review
Western Blot CACNB2 H00000783-M05
Enlarge
 Abby Sewell
12/01/2014
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol CACNB2
Entrez
OMIM
Uniprot