CACNB2 Antibody (6C4)

Images

 
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in Hela S3 NE (Cat # L013V3).
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - analysis of CACNB2 in HEK293 and CHO whole cell lysates using anti-CACNB2 antibody. Image from verified customer review.
Western Blot: CACNB2 Antibody (6C4) [H00000783-M05] - Analysis of CACNB2 expression in NIH/3T3 (Cat # L018V1).
ELISA: CACNB2 Antibody (6C4) [H00000783-M05] - Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
6C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CACNB2 Antibody (6C4) Summary

Immunogen
CACNB2 (NP_963890 213 a.a. - 301 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ
Specificity
CACNB2 - calcium channel, voltage-dependent, beta 2 subunit
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CACNB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Reviewed Applications
Read 1 Review rated 4
using
H00000783-M05 in the following applications:

Publications
Read Publications using H00000783-M05.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CACNB2 Antibody (6C4)

  • CAB2
  • CACNLB2
  • Calcium channel voltage-dependent subunit beta 2
  • calcium channel, voltage-dependent, beta 2 subunit
  • CAVB2
  • FLJ23743
  • Lambert-Eaton myasthenic syndrome antigen B
  • myasthenic (Lambert-Eaton) syndrome antigen B
  • MYSB
  • voltage-dependent L-type calcium channel subunit beta-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5489
Species: Hu
Applications: WB, IHC
NBP1-86589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00010948-P01
Species: Hu
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-83984
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12907
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2864
Species: Hu, Mu, Rt, Po, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-12893
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP2-13914
Species: Hu
Applications: ICC/IF, IHC, IHC-P
37470002
Species: Hu
Applications: WB, ELISA
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52926
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CACNB2 Antibody (H00000783-M05)(2)

Review for CACNB2 Antibody (H00000783-M05) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00000783-M05:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CACNB2 H00000783-M05
Enlarge
reviewed by:
Abby Sewell
WB Human 12/01/2014
View

Summary

ApplicationWestern Blot
Sample TestedHEK293 and CHO Whole cell lysates, CHO stably transfected with CACNA1C, CACNB2, and CACNA2D (ChanTest, CT-6004)
SpeciesHuman

Blocking

Blocking Details5% Non-fat Dry Milk in TBST, 1 hour, room temperature

Primary Anitbody

Dilution Ratio1:500, 2 hours at room temperature, 5% Non-fat dry milk in TBST

Secondary Antibody

Secondary DescriptionGoat anti-mouse IgG-HRP
Secondary Manufacturer Cat#sc-2005
Secondary Concentration1:10,000

Details

Detection NotesECL was used to visualize bands. Blots were imaged using a ChemiDoc XRS+ (Bio-Rad), exposure was 10 minutes.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNB2 Antibody (H00000783-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNB2 Products

Bioinformatics Tool for CACNB2 Antibody (H00000783-M05)

Discover related pathways, diseases and genes to CACNB2 Antibody (H00000783-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNB2 Antibody (H00000783-M05)

Discover more about diseases related to CACNB2 Antibody (H00000783-M05).
 

Pathways for CACNB2 Antibody (H00000783-M05)

View related products by pathway.

PTMs for CACNB2 Antibody (H00000783-M05)

Learn more about PTMs related to CACNB2 Antibody (H00000783-M05).

Blogs on CACNB2

There are no specific blogs for CACNB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Abby Sewell
12/01/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol CACNB2
Entrez
OMIM
Uniprot