![Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Analysis in human kidney and skeletal muscle tissues. Corresponding CGNL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/CGNL1-Antibody-Immunohistochemistry-Paraffin-NBP2-37959-img0008.jpg "Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Analysis in human kidney and skeletal muscle tissues. Corresponding CGNL1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NEKVEENSTLQQRLEESEGELRKNLEELFQVKMEREQHQTEIRDLQDQLSEMHDELDSAKRSEDREKGALIEELLQAKQDLQDLLIAK |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CGNL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
-Western-Blot-NBP2-02500-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-02500-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-02500-img0003.jpg)
-Immunohistochemistry-NBP2-45646-img0001.jpg)
-Immunohistochemistry-NBP2-45646-img0002.jpg)
-Immunohistochemistry-NBP2-45646-img0003.jpg)
-Immunohistochemistry-Frozen-NBP2-59690-img0002.jpg)
-Western-Blot-NBP2-59690-img0004.jpg)
-Immunohistochemistry-NBP2-59690-img0006.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for CGNL1 Antibody (NBP2-37959)Discover more about diseases related to CGNL1 Antibody (NBP2-37959).
| Pathways for CGNL1 Antibody (NBP2-37959)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: CGNL1 Antibody [NBP2-37959] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://images.novusbio.com/fullsize2/CGNL1-Antibody-Western-Blot-NBP2-37959-img0003.jpg "Western Blot: CGNL1 Antibody [NBP2-37959] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG")
![Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human stomach shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/CGNL1-Antibody-Immunohistochemistry-Paraffin-NBP2-37959-img0012.jpg "Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human stomach shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human kidney shows strong membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize2/CGNL1-Antibody-Immunohistochemistry-Paraffin-NBP2-37959-img0009.jpg "Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human kidney shows strong membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human prostate shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/CGNL1-Antibody-Immunohistochemistry-Paraffin-NBP2-37959-img0010.jpg "Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human prostate shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize2/CGNL1-Antibody-Immunohistochemistry-Paraffin-NBP2-37959-img0011.jpg "Immunohistochemistry-Paraffin: CGNL1 Antibody [NBP2-37959] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![N/A TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images2/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")