CSK Antibody

Images

 
Western Blot: CSK Antibody [NBP1-85951] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CSK Antibody [NBP1-85951] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in lymphoid cells.
Western Blot: CSK Antibody [NBP1-85951] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Western Blot: CSK Antibody [NBP1-85951] - Analysis in human cell line RT-4 and human cell line HeLa.
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells and cells in granular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CSK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CSK Protein (NBP1-85951PEP)
Publications
Read Publication using NBP1-85951.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22665063)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CSK Antibody

  • CSK
  • C-Src kinase
  • c-src tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • MGC117393
  • Protein-tyrosine kinase CYL
  • tyrosine-protein kinase CSK

Background

Specifically phosphorylates 'Tyr-504' on LCK, which acts as a negative regulatory site. Can also act on theLYN and FYN kinases

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CSK Antibody (NBP1-85951)(1)

Reviews for CSK Antibody (NBP1-85951) (0)

There are no reviews for CSK Antibody (NBP1-85951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSK Antibody (NBP1-85951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CSK Products

Research Areas for CSK Antibody (NBP1-85951)

Find related products by research area.

Blogs on CSK

There are no specific blogs for CSK, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CSK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSK