CSK Antibody


Western Blot: CSK Antibody [NBP1-85951] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CSK Antibody [NBP1-85951] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.
Western Blot: CSK Antibody [NBP1-85951] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

CSK Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH
Specificity of human, mouse, rat CSK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
CSK Lysate (NBP2-65714)
Control Peptide
CSK Protein (NBP1-85951PEP)
Read Publication using NBP1-85951.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22665063)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CSK Antibody

  • C-Src kinase
  • c-src tyrosine kinase
  • EC 2.7.10
  • EC
  • MGC117393
  • Protein-tyrosine kinase CYL
  • tyrosine-protein kinase CSK


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for CSK Antibody (NBP1-85951)(1)

Reviews for CSK Antibody (NBP1-85951) (0)

There are no reviews for CSK Antibody (NBP1-85951). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CSK Antibody (NBP1-85951) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional CSK Products

Bioinformatics Tool for CSK Antibody (NBP1-85951)

Discover related pathways, diseases and genes to CSK Antibody (NBP1-85951). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CSK Antibody (NBP1-85951)

Discover more about diseases related to CSK Antibody (NBP1-85951).

Pathways for CSK Antibody (NBP1-85951)

View related products by pathway.

PTMs for CSK Antibody (NBP1-85951)

Learn more about PTMs related to CSK Antibody (NBP1-85951).

Research Areas for CSK Antibody (NBP1-85951)

Find related products by research area.

Blogs on CSK

There are no specific blogs for CSK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CSK Antibody and receive a gift card or discount.


Gene Symbol CSK