PLD3/Phospholipase D3 Antibody

Images

 
Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-83146] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: PLD3/Phospholipase D3 Antibody [NBP1-83146] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLD3/Phospholipase D3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQLQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSAN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLD3/Phospholipase D3 Protein (NBP1-83146PEP)
Publications
Read Publication using
NBP1-83146 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25478031).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLD3/Phospholipase D3 Antibody

  • Choline phosphatase 3
  • EC 3.1.4
  • EC 3.1.4.4
  • HindIII K4L homolog
  • HUK4
  • HU-K4
  • Phosphatidylcholine-hydrolyzing phospholipase D3
  • phospholipase D family, member 3
  • phospholipase D3
  • PLD 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20154
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF2749
Species: Mu
Applications: WB, Flow, IP, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF3327
Species: Mu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-83146
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PLD3/Phospholipase D3 Antibody (NBP1-83146)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PLD3/Phospholipase D3 Antibody (NBP1-83146) (0)

There are no reviews for PLD3/Phospholipase D3 Antibody (NBP1-83146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLD3/Phospholipase D3 Antibody (NBP1-83146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLD3/Phospholipase D3 Products

Bioinformatics Tool for PLD3/Phospholipase D3 Antibody (NBP1-83146)

Discover related pathways, diseases and genes to PLD3/Phospholipase D3 Antibody (NBP1-83146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLD3/Phospholipase D3 Antibody (NBP1-83146)

Discover more about diseases related to PLD3/Phospholipase D3 Antibody (NBP1-83146).

PTMs for PLD3/Phospholipase D3 Antibody (NBP1-83146)

Learn more about PTMs related to PLD3/Phospholipase D3 Antibody (NBP1-83146).

Blogs on PLD3/Phospholipase D3

There are no specific blogs for PLD3/Phospholipase D3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLD3/Phospholipase D3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLD3