PLD3/Phospholipase D3 Antibody - BSA Free

Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml

Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Human Heart lysate, concentration 0.2-1 ug/ml.

Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PLD3/Phospholipase D3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PLD3/Phospholipase D3 The peptide sequence was selected from the N terminal of PLD3/Phospholipase D3. Peptide sequence WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PLD3/Phospholipase D3 Antibody - BSA Free

• Choline phosphatase 3
• EC 3.1.4
• EC 3.1.4.4
• HindIII K4L homolog
• HUK4
• HU-K4
• Phosphatidylcholine-hydrolyzing phospholipase D3
• phospholipase D family, member 3
• phospholipase D3
• PLD 3

Background

PLD3/Phospholipase D3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PLD3/Phospholipase D3 Antibody (NBP1-59921)(1)

Publication using NBP1-59921

• Walker LC, Waddell N, Ten Haaf A et al. Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers. Breast Cancer Res Treat 2008-11-01 [PMID: 18095154]

Bioinformatics

• Gene Symbol: PLD3
• Entrez:
  • 23646(Human)
• Uniprot:
  • Q8IV08(Human)