PKA 2 beta Antibody - BSA Free

Immunohistochemistry-Paraffin: PKA 2 beta Antibody [NBP1-80879] - Analysis in human adipose tissue and skeletal muscle tissues using NBP1-80879 antibody. Corresponding PKA 2 beta RNA-seq data are presented for the same tissues.

Western Blot: PKA 2 beta Antibody [NBP1-80879] - Analysis in human cell line Daudi.

Immunohistochemistry-Paraffin: PKA 2 beta Antibody [NBP1-80879] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: PKA 2 beta Antibody [NBP1-80879] - Staining of human soft tissue shows distinct positivity in adipocytes.

Immunohistochemistry-Paraffin: PKA 2 beta Antibody [NBP1-80879] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: PKA 2 beta Antibody [NBP1-80879] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKA 2 beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIH
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKAR2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PKA 2 beta Protein (NBP1-80879PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PKA 2 beta Antibody - BSA Free

• cAMP-dependent protein kinase type II-beta regulatory chain
• cAMP-dependent protein kinase type II-beta regulatory subunit
• H_RG363E19.2
• PKA 2 beta
• PRKAR2
• PRKAR2B
• protein kinase, cAMP-dependent, regulatory, type II, beta
• RII-BETA
• WUGSC:H_RG363E19.2

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is one of the regulatory subunits. This subunit can be phosphorylated by the activated catalytic subunit. This subunit has been shown to interact with and suppress the transcriptional activity of the cAMP responsive element binding protein 1 (CREB1) in activated T cells. Knockout studies in mice suggest that this subunit may play an important role in regulating energy balance and adiposity. The studies also suggest that this subunit may mediate the gene induction and cataleptic behavior induced by haloperidol.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PKA 2 beta Antibody (NBP1-80879)(2)

Publications using NBP1-80879

• Fitzgerald, G, G Fibro-adipogenic progenitor heterogeneity in healthy and diseased skeletal muscle Thesis 2022-01-01
• Jorge MV From DNA Damage Repair to Cellular Plasticity: How Cancer Cells Respond to Genotoxic Stress Thesis 2022-01-01

Bioinformatics

• Gene Symbol: PRKAR2B
• Entrez:
  • 5577(Human)
• Uniprot:
  • P31323(Human)