GPR22 Antibody - Azide and BSA Free

Western Blot: GPR22 Antibody [NBP3-15567] - Western blot analysis of extracts of various cell lines, using GPR22 antibody (NBP3-15567) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: GPR22 Antibody [NBP3-15567] - Immunofluorescence analysis of U-2 OS cells using GPR22 antibody (NBP3-15567) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: GPR22 Antibody [NBP3-15567] - Immunofluorescence analysis of L929 cells using GPR22 antibody (NBP3-15567) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GPR22 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit GPR22 Antibody - Azide and BSA Free (NBP3-15567) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GPR22 (NP_005286.2). MCFSPILEINMQSESNITVRDDIDDINTNMYQPLSYPLSFQVSLTGFLMLEIVLGLGSNLTVLVLYCMKSNLINSVSNIITMNLHVLDVIICVGCIPLTI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GPR22
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for GPR22 Antibody - Azide and BSA Free

• G protein-coupled receptor 22
• GPR22
• MGC129847
• probable G-protein coupled receptor 22

Background

GPR22 is an Orphan-A GPCR with no known ligand. GPR22 has been reported to be expressed in many regions of the brain including frontal cortex, caudate, putamen, and thalamus but not in pons, hypothalamus, or hippocampus. ESTs have been isolated from human brain and heart libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: GPR22