PINX1 Antibody

Images

 
Western Blot: PINX1 Antibody [NBP1-83643] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PINX1 Antibody [NBP1-83643] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PINX1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP
Specificity
Specificity of human PINX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PINX1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
PINX1 Recombinant Protein Antigen (NBP1-83643PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PINX1 Antibody

  • FLJ20565
  • hepatocellular carcinoma-related putative tumor suppressor
  • Liver-related putative tumor suppressor
  • LPTLPinX1
  • LPTS67-11-3 protein
  • MGC8850
  • PIN2 interacting protein 1
  • PIN2/TERF1 interacting, telomerase inhibitor 1
  • PIN2/TERF1-interacting telomerase inhibitor 1
  • PIN2-interacting protein 1
  • Pin2-interacting protein X1
  • Protein 67-11-3
  • TRF1-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1522
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-81615
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-176
Species: Hu
Applications: WB
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-186
Species: Hu
Applications: WB, ICC/IF
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
H00065057-M02
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for PINX1 Antibody (NBP1-83643) (0)

There are no publications for PINX1 Antibody (NBP1-83643).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PINX1 Antibody (NBP1-83643) (0)

There are no reviews for PINX1 Antibody (NBP1-83643). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PINX1 Antibody (NBP1-83643) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PINX1 Antibody (NBP1-83643)

Discover related pathways, diseases and genes to PINX1 Antibody (NBP1-83643). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PINX1 Antibody (NBP1-83643)

Discover more about diseases related to PINX1 Antibody (NBP1-83643).
 

Pathways for PINX1 Antibody (NBP1-83643)

View related products by pathway.

PTMs for PINX1 Antibody (NBP1-83643)

Learn more about PTMs related to PINX1 Antibody (NBP1-83643).

Blogs on PINX1

There are no specific blogs for PINX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PINX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PINX1