PINK1 Recombinant Protein Antigen

Images

 
There are currently no images for PINK1 Recombinant Protein Antigen (NBP2-54666PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PINK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PINK1

Source: E.coli

Amino Acid Sequence: GVDHLVQQGIAHRDLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNGCLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHLESRSYQEAQLP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PINK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-54666. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for PINK1 Recombinant Protein Antigen

  • BRPK
  • EC 2.7.11.1
  • FLJ27236
  • PARK6
  • Parkinson disease (autosomal recessive) 6
  • PINK1
  • protein kinase BRPK
  • PTEN induced putative kinase 1
  • PTEN-induced putative kinase protein 1
  • serine/threonine-protein kinase PINK1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, In vitro
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67017
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75449
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-66383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-54666PEP
Species: Hu
Applications: AC

Publications for PINK1 Recombinant Protein Antigen (NBP2-54666PEP) (0)

There are no publications for PINK1 Recombinant Protein Antigen (NBP2-54666PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PINK1 Recombinant Protein Antigen (NBP2-54666PEP) (0)

There are no reviews for PINK1 Recombinant Protein Antigen (NBP2-54666PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PINK1 Recombinant Protein Antigen (NBP2-54666PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PINK1 Recombinant Protein Antigen (NBP2-54666PEP)

Discover related pathways, diseases and genes to PINK1 Recombinant Protein Antigen (NBP2-54666PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PINK1 Recombinant Protein Antigen (NBP2-54666PEP)

Discover more about diseases related to PINK1 Recombinant Protein Antigen (NBP2-54666PEP).
 

Pathways for PINK1 Recombinant Protein Antigen (NBP2-54666PEP)

View related products by pathway.

PTMs for PINK1 Recombinant Protein Antigen (NBP2-54666PEP)

Learn more about PTMs related to PINK1 Recombinant Protein Antigen (NBP2-54666PEP).
 

Research Areas for PINK1 Recombinant Protein Antigen (NBP2-54666PEP)

Find related products by research area.

Blogs on PINK1. Showing 1-10 of 12 blog posts - Show all blog posts.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amyloid beta (a polypepti...  Read full blog post.

There's an autophagy for that!
By Christina Towers, PhDA critical mechanism that cells use to generate nutrients and fuel metabolism is through a process called autophagy.  This process is complex and involves over 20 different proteins, most of which are highly conserved acro...  Read full blog post.

The role of Parkin and autophagy in retinal pigment epithelial cell (RPE) degradation
The root of Parkinson’s disease (PD) points to a poorly regulated electron transport chain leading to mitochondrial damage, where many proteins need to work cohesively to ensure proper function.  The two key players of this pathway are PINK1,...  Read full blog post.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease
Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit...  Read full blog post.

PINK1 - performing mitochondrial quality control and protecting against Parkinson’s disease
PTEN-induced putative kinase 1 (PINK1) is a serine/threonine kinase with important functions in mitochondrial quality control. Together with the Parkin protein, PINK1 is able to regulate the selective degradation of damaged mitochondria through aut...  Read full blog post.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

PINK1 and its role in Parkinson's disease
PINK1 (PTEN induced putative kinase 1) is a mitochondrial serine/threonine kinase which maintains mitochondrial function/integrity, provides protection against mitochondrial dysfunction during cellular stress, potentially by phosphorylating mitochondr...  Read full blog post.

PINK1: Promoting Organelle Stability and Preventing Parkinson's disease
PINK1 is a protein serine/threonine kinase (PTK) that protects the organelles from cellular stress and controls selective autophagy to clear damage. Exner, et al. were among the first to report that PINK1 deficiency in humans was linked to autosomal r...  Read full blog post.

PINK1: Promoting Organelle Stability and Preventing Parkinson's disease
PINK1 is a protein serine/threonine kinase (PTK) that protects the organelles from cellular stress and controls selective autophagy to clear damage. Exner, et. al. were among the first to report that PINK1 deficiency in humans was linked to autosomal...  Read full blog post.

Showing 1-10 of 12 blog posts - Show all blog posts.

Customers Who Bought This Also Bought

LRRK2 Antibody
NB300-268
PINK1 Antibody
BC100-494
DRP1 Antibody
NB110-55288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PINK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PINK1