PIMT Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIMT. Source: E. coli Amino Acid Sequence: KHPGQALSSEPWNFPDTKEEWEQHYSQLYWYYLEQFQYWEAQGWTFDASQSCDTDTYTSKTEADDKNDEKCMKVDLVSFPSSPIMVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TGS1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56790. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PIMT Recombinant Protein Antigen
Background
Nuclear receptor coactivators participate in the transcriptional activation of specific genes by nuclear receptors. A new nuclear receptor coactivator-interacting protein, designated PIMT, was identified from a human liver cDNA library by using the coactivator peroxisome proliferator-activated receptor-interacting protein (PRIP) as bait in a yeast 2-hybrid screen. The PIMT cDNA encodes an 852-amino acid protein containing a 9-amino acid methyltransferase motif I (VVDAFCGVG) and an invariant segment (GXXGXXI) found in K-homology motifs of many RNA-binding proteins. Northern blot analysis demonstrated ubiquitous expression of a 3.2-kb PIMT transcript, with highest expression in heart, skeletal muscle, kidney, liver, and placenta. Immunofluorescence studies showed that the PIMT and PRIP proteins are colocalized in the nucleus. PIMT binds 5-adenosyl-L-methionine, the methyl donor for the methyltransfer reaction, and it also binds RNA, suggesting that it is an RNA methyltransferase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Av, Bv, Sh
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: AC
Publications for PIMT Recombinant Protein Antigen (NBP2-56790PEP) (0)
There are no publications for PIMT Recombinant Protein Antigen (NBP2-56790PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIMT Recombinant Protein Antigen (NBP2-56790PEP) (0)
There are no reviews for PIMT Recombinant Protein Antigen (NBP2-56790PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PIMT Recombinant Protein Antigen (NBP2-56790PEP) (0)
Additional PIMT Products
Research Areas for PIMT Recombinant Protein Antigen (NBP2-56790PEP)
Find related products by research area.
|
Blogs on PIMT