PIM2 Antibody (3V1S5)

Western Blot: PIM2 Antibody (3V1S5) [NBP3-16789] - Western blot analysis of extracts of various cell lines, using PIM2 Rabbit mAb (NBP3-16789) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunoprecipitation: PIM2 Antibody (3V1S5) [NBP3-16789] - Immunoprecipitation analysis of 300ug extracts of Raji cells using 3ug PIM2 antibody (NBP3-16789). Western blot was performed from the immunoprecipitate using PIM2 antibody (NBP3-16789) at a dilition of 1:1000.

Western Blot: PIM2 Antibody (3V1S5) [NBP3-16789] - Western blot analysis of various lysates, using PIM2 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IP
• Clone: 3V1S5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PIM2 Antibody (3V1S5) Summary

• Description: Novus Biologicals Rabbit PIM2 Antibody (3V1S5) (NBP3-16789) is a recombinant monoclonal antibody validated for use in WB and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 10-120 of human PIM2 (NP_006866.2). PAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PIM2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIM2 Antibody (3V1S5)

• EC 2.7.11.1
• pim-2 oncogene
• PIM2
• pim-2h
• proto-oncogene Pim-2 (serine threonine kinase)
• serine/threonine protein kinase pim-2
• serine/threonine-protein kinase pim-2

Background

PIM2 belongs to a family of cytoplasmic serine/threonine protein kinases that consists of two other members, PIM1 and PIM3. Expression of this protein is regulated by hematopoietic cytokines. PIM2 is most abundantly expressed in hematopoietic tissues, spleen, thymus, and peripheral blood leukocytes, as well as in testis, small intestine, and colon. It is also highly expressed in human leukemic and lymphoma cell lines. The gene is also expressed in primary spermatocytes. The results suggest a role for PIM2 in proliferating cells as well as during meiosis. PIM2 is thought to be a mediator of p53 mediated apoptosis inhibition by interleukin 3, which supports its role in the formation of various tumours including lymphomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIM2