PILR-alpha Antibody - BSA Free

Immunohistochemistry-Paraffin: PILR-alpha Antibody [NBP2-55310] - Staining of human tonsil shows cytoplasmic positivity in both germinal and non-germinal center cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PILR-alpha Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALSSSTSPRAPPSHRPLKSPQNETLYSVLK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PILRA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PILR-alpha Recombinant Protein Antigen (NBP2-55310PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PILR-alpha Antibody - BSA Free

• Cell surface receptor FDF03
• FDF03
• inhibitory receptor PILRalpha
• Inhibitory receptor PILR-alpha
• paired immunoglobin-like receptor alpha
• paired immunoglobin-like type 2 receptor alpha
• paired immunoglobulin-like receptor alpha
• paired immunoglobulin-like type 2 receptor alpha
• PILRA
• PILRalpha
• PILR-alpha

Background

Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role. Alternative splicing has been observed at this locus and three variants, each encoding a distinct isoform, are described. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PILRA