PILR-alpha Antibody


Western Blot: PILRA Antibody [NBP1-60095] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PILR-alpha Antibody Summary

Synthetic peptides corresponding to PILRA(paired immunoglobin-like type 2 receptor alpha) The peptide sequence was selected from the N terminal of PILRA. Peptide sequence IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PILRA and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PILR-alpha Antibody

  • Cell surface receptor FDF03
  • FDF03
  • inhibitory receptor PILRalpha
  • Inhibitory receptor PILR-alpha
  • paired immunoglobin-like receptor alpha
  • paired immunoglobin-like type 2 receptor alpha
  • paired immunoglobulin-like receptor alpha
  • paired immunoglobulin-like type 2 receptor alpha
  • PILRalpha
  • PILR-alpha


Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role.Cell signaling pathways rely on a dynamic interaction between activating and inhibiting processes. SHP-1-mediated dephosphorylation of protein tyrosine residues is central to the regulation of several cell signaling pathways. Two types of inhibitory receptor superfamily members are immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptors and their non-ITIM-bearing, activating counterparts. Control of cell signaling via SHP-1 is thought to occur through a balance between PILRalpha-mediated inhibition and PILRbeta-mediated activation. These paired immunoglobulin-like receptor genes are located in a tandem head-to-tail orientation on chromosome 7. This particular gene encodes the ITIM-bearing member of the receptor pair, which functions in the inhibitory role. Alternative splicing has been observed at this locus and three variants, each encoding a distinct isoform, are described.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Rt, Hu(-)
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, Simple Western, IHC
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB

Publications for PILR-alpha Antibody (NBP1-60095) (0)

There are no publications for PILR-alpha Antibody (NBP1-60095).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PILR-alpha Antibody (NBP1-60095) (0)

There are no reviews for PILR-alpha Antibody (NBP1-60095). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PILR-alpha Antibody (NBP1-60095) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PILR-alpha Products

Bioinformatics Tool for PILR-alpha Antibody (NBP1-60095)

Discover related pathways, diseases and genes to PILR-alpha Antibody (NBP1-60095). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PILR-alpha Antibody (NBP1-60095)

Discover more about diseases related to PILR-alpha Antibody (NBP1-60095).

Pathways for PILR-alpha Antibody (NBP1-60095)

View related products by pathway.

PTMs for PILR-alpha Antibody (NBP1-60095)

Learn more about PTMs related to PILR-alpha Antibody (NBP1-60095).

Research Areas for PILR-alpha Antibody (NBP1-60095)

Find related products by research area.

Blogs on PILR-alpha

There are no specific blogs for PILR-alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PILR-alpha Antibody and receive a gift card or discount.


Gene Symbol PILRA