PIK3R4 Antibody (5J3U5)

Western Blot: PIK3R4 Antibody (5J3U5) [NBP3-16612] - Western blot analysis of extracts of various cell lines, using PIK3R4 Rabbit mAb (NBP3-16612) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: PIK3R4 Antibody (5J3U5) [NBP3-16612] - Immunofluorescence analysis of NIH-3T3 cells using PIK3R4 Rabbit mAb (NBP3-16612) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Western Blot: PIK3R4 Antibody (5J3U5) [NBP3-16612] - Western blot analysis of extracts of Rat brain, using PIK3R4 Rabbit mAb (NBP3-16612) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: PIK3R4 Antibody (5J3U5) [NBP3-16612] - Immunofluorescence analysis of HeLa cells using PIK3R4 Rabbit mAb (NBP3-16612) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: PIK3R4 Antibody (5J3U5) [NBP3-16612] - Confocal imaging of NIH/3T3 cells using PIK3R4 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 5J3U5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

PIK3R4 Antibody (5J3U5) Summary

• Description: Novus Biologicals Rabbit PIK3R4 Antibody (5J3U5) (NBP3-16612) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4 (Q99570). AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PIK3R4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIK3R4 Antibody (5J3U5)

• EC 2.7.11.1
• MGC102700
• p150
• phosphatidylinositol 3-kinase-associated p150
• Phosphoinositide 3-kinase adaptor protein
• phosphoinositide 3-kinase regulatory subunit 4
• phosphoinositide-3-kinase, regulatory subunit 4
• phosphoinositide-3-kinase, regulatory subunit 4, p150
• PI3-kinase p150 subunit
• PI3-kinase regulatory subunit 4
• PIK3R4
• VPS 15
• VPS15

Background

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3R4