PIK3C2G Antibody - BSA Free

Staining of human cell line GAMG shows localization to plasma membrane.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIK3C2G Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PIK3C2G Antibody - BSA Free (NBP3-25052) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein PIK3C2G using the following amino acid sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIK3C2G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PIK3C2G Antibody - BSA Free

• EC 2.7.1
• EC 2.7.1.154
• MGC163149
• phosphatidylinositol 3-kinase C2 domain-containing gamma
• phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing gammapolypeptide
• phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit gamma
• Phosphoinositide 3-kinase-C2-gamma
• phosphoinositide-3-kinase, class 2, gamma polypeptide
• PI3K-C2GAMMA
• PI3K-C2-gamma
• PIK3C2G
• PTDINS-3-kinase C2 gamma
• PtdIns-3-kinase C2 subunit gamma

Background

PIK3C2G, also known as Phosphatidylinositol-4-Phosphate 3-Kinase, Catalytic Subunit Type 2 Gamma, is 1,485 amino acids long and approximately 171 kDa. PIK3C2G belongs to the PI 3-Kinase family. Although little is known about the function of PIK3C2G, PI3K family members play a role in the regulation of intracellular trafficking, cell survival and proliferation, and oncogenesis. PIK3C2G research is currently being conducted in relation to several diseases and disorders such as alcoholism, schizophrenia and Kaposi's sarcoma. PIK3C2G has been shown to have interactions with other PI3/PI4-kinase members such as PI4KA, PI4KB, PI4K2A, PI4K2B and PIP5K1B in pathways including the mTOR pathway, TGF-beta Pathway, NF-kappaB Pathway and Phosphatidylinositol signaling system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIK3C2G