PIK3C2G Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PIK3C2G Antibody - BSA Free (NBP3-25052) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein PIK3C2G using the following amino acid sequence: PNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PIK3C2G |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
| Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, pH 7.2, 40% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PIK3C2G Antibody - BSA Free
Background
PIK3C2G, also known as Phosphatidylinositol-4-Phosphate 3-Kinase, Catalytic Subunit Type 2 Gamma, is 1,485 amino acids long and approximately 171 kDa. PIK3C2G belongs to the PI 3-Kinase family. Although little is known about the function of PIK3C2G, PI3K family members play a role in the regulation of intracellular trafficking, cell survival and proliferation, and oncogenesis. PIK3C2G research is currently being conducted in relation to several diseases and disorders such as alcoholism, schizophrenia and Kaposi's sarcoma. PIK3C2G has been shown to have interactions with other PI3/PI4-kinase members such as PI4KA, PI4KB, PI4K2A, PI4K2B and PIP5K1B in pathways including the mTOR pathway, TGF-beta Pathway, NF-kappaB Pathway and Phosphatidylinositol signaling system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IP, KO, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Publications for PIK3C2G Antibody (NBP3-25052) (0)
There are no publications for PIK3C2G Antibody (NBP3-25052).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIK3C2G Antibody (NBP3-25052) (0)
There are no reviews for PIK3C2G Antibody (NBP3-25052).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PIK3C2G Antibody (NBP3-25052) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIK3C2G Products
Research Areas for PIK3C2G Antibody (NBP3-25052)
Find related products by research area.
|
Blogs on PIK3C2G