RASSF2 Antibody

Images

 
Western Blot: RASSF2 Antibody [NBP2-13206] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: RASSF2 Antibody [NBP2-13206] - Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: RASSF2 Antibody [NBP2-13206] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RASSF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEG DQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RASSF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RASSF2 Protein (NBP2-13206PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RASSF2 Antibody

  • KIAA0168DKFZp781O1747
  • Ras association (RalGDS/AF-6) domain family 2
  • Ras association (RalGDS/AF-6) domain family member 2
  • ras association domain-containing protein 2
  • RASFADIN
  • RASSF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89425
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-89249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NB100-56552
Species: Hu
Applications: WB
NBP2-20163
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-55145
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP2-13206
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RASSF2 Antibody (NBP2-13206) (0)

There are no publications for RASSF2 Antibody (NBP2-13206).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RASSF2 Antibody (NBP2-13206) (0)

There are no reviews for RASSF2 Antibody (NBP2-13206). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RASSF2 Antibody (NBP2-13206) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RASSF2 Products

Bioinformatics Tool for RASSF2 Antibody (NBP2-13206)

Discover related pathways, diseases and genes to RASSF2 Antibody (NBP2-13206). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RASSF2 Antibody (NBP2-13206)

Discover more about diseases related to RASSF2 Antibody (NBP2-13206).
 

Pathways for RASSF2 Antibody (NBP2-13206)

View related products by pathway.

PTMs for RASSF2 Antibody (NBP2-13206)

Learn more about PTMs related to RASSF2 Antibody (NBP2-13206).
 

Research Areas for RASSF2 Antibody (NBP2-13206)

Find related products by research area.

Blogs on RASSF2

There are no specific blogs for RASSF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RASSF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RASSF2
Entrez