PIGT Antibody

Images

 
Western Blot: PIGT Antibody [NBP1-69585] - This Anti-PIGT antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.
Western Blot: PIGT Antibody [NBP1-69585] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PIGT is supported by BioGPS gene expression data to be expressed in 721_B.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIGT Antibody Summary

Immunogen
Synthetic peptides corresponding to PIGT(phosphatidylinositol glycan anchor biosynthesis, class T) The peptide sequence was selected from the N terminal of PIGT. Peptide sequence PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIGT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PIGT and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIGT Antibody

  • FLJ41596
  • GPI transamidase component PIG-T
  • GPI transamidase subunit
  • MGC8909
  • NDAP
  • neurotrophin-regulated neuronal development-associated protein
  • phosphatidyl inositol glycan class T
  • phosphatidylinositol glycan anchor biosynthesis, class T
  • phosphatidylinositol glycan, class T
  • Phosphatidylinositol-glycan biosynthesis class T protein

Background

PIGT is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
H00006919-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-84936
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2803
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-81512
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-98474
Species: Hu
Applications: WB
H00171023-M05
Species: Hu
Applications: WB, ELISA
NBP1-69585
Species: Hu
Applications: WB

Publications for PIGT Antibody (NBP1-69585) (0)

There are no publications for PIGT Antibody (NBP1-69585).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGT Antibody (NBP1-69585) (0)

There are no reviews for PIGT Antibody (NBP1-69585). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGT Antibody (NBP1-69585) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGT Products

Bioinformatics Tool for PIGT Antibody (NBP1-69585)

Discover related pathways, diseases and genes to PIGT Antibody (NBP1-69585). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGT Antibody (NBP1-69585)

Discover more about diseases related to PIGT Antibody (NBP1-69585).
 

Pathways for PIGT Antibody (NBP1-69585)

View related products by pathway.

PTMs for PIGT Antibody (NBP1-69585)

Learn more about PTMs related to PIGT Antibody (NBP1-69585).

Blogs on PIGT

There are no specific blogs for PIGT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGT
Uniprot