PIBF1 Antibody


Western Blot: PIBF1 Antibody [NBP2-56805] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: PIBF1 Antibody [NBP2-56805] - Staining of human cell line U-251 MG shows localization to microtubule organizing center.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

PIBF1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QELMKQEMETILLRQKQLEETNLQLREKAGDVRRNLRDFELTEEQYIKLKAFPEDQLSIPEYVSVRFYELVNPLRKEICELQVKKNILAEELSTNK
Specificity of human PIBF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIBF1 Recombinant Protein Antigen (NBP2-56805PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PIBF1 Antibody

  • C13orf24
  • chromosome 13 open reading frame 24
  • KIAA1008
  • PIBF
  • PIBF1
  • progesterone immunomodulatory binding factor 1
  • progesterone-induced blocking factor 1
  • progesterone-induced-blocking factor 1
  • RP11-505F3.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, B/N, CyTOF-ready, Flow-CS
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: WB, Block

Publications for PIBF1 Antibody (NBP2-56805) (0)

There are no publications for PIBF1 Antibody (NBP2-56805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIBF1 Antibody (NBP2-56805) (0)

There are no reviews for PIBF1 Antibody (NBP2-56805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIBF1 Antibody (NBP2-56805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PIBF1 Products

Bioinformatics Tool for PIBF1 Antibody (NBP2-56805)

Discover related pathways, diseases and genes to PIBF1 Antibody (NBP2-56805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIBF1 Antibody (NBP2-56805)

Discover more about diseases related to PIBF1 Antibody (NBP2-56805).

Pathways for PIBF1 Antibody (NBP2-56805)

View related products by pathway.

PTMs for PIBF1 Antibody (NBP2-56805)

Learn more about PTMs related to PIBF1 Antibody (NBP2-56805).

Blogs on PIBF1

There are no specific blogs for PIBF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIBF1 Antibody and receive a gift card or discount.


Gene Symbol PIBF1