Phosphoserine phosphatase Antibody


Western Blot: Phosphoserine phosphatase Antibody [NBP1-56848] - Analysis of PSPH in human PSPH overexpressed glioma (Lane1) and non-transfected (Lane2) cells using anti-PSPH (Phosphoserine phosphatase) antibody. Image more
Western Blot: Phosphoserine phosphatase Antibody [NBP1-56848] - Human Heart lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Phosphoserine phosphatase Antibody Summary

Synthetic peptides corresponding to PSPH(phosphoserine phosphatase) The peptide sequence was selected from the middle region of PSPH. Peptide sequence IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PSPH and was validated on Western blot.
Reviewed Applications
Read 1 Review rated 5
NBP1-56848 in the following application:

Read Publication using
NBP1-56848 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Phosphoserine phosphatase Antibody

  • L-3-phosphoserine phosphatase
  • O-phosphoserine phosphohydrolase
  • phosphoserine phosphatase
  • PSPase


The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, Block
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for Phosphoserine phosphatase Antibody (NBP1-56848)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Review for Phosphoserine phosphatase Antibody (NBP1-56848) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-56848:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Phosphoserine phosphatase NBP1-56848
reviewed by:
WB Human 06/04/2016


ApplicationWestern Blot
Sample TestedHuman glioma cells transfected with PSPH ORF (Lane1) or non trasfected (Lane2)


Blocking Details5% non fat dried milk in TBS-T

Primary Anitbody

Dilution Ratio1:500 in 3% BSA in TBS, 4 degree overnight incubation

Secondary Antibody

Secondary DescriptionGoat anti rabbit-HRP
Secondary Manufacturer Cat#31460
Secondary Concentration1:10,000


Detection NotesBlot was incubated with ECL-femto (Pierce) for 2 min. X-ray film was overlaid in dark and processed through Kodak x-omat.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phosphoserine phosphatase Antibody (NBP1-56848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Phosphoserine phosphatase Antibody (NBP1-56848)

Discover related pathways, diseases and genes to Phosphoserine phosphatase Antibody (NBP1-56848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphoserine phosphatase Antibody (NBP1-56848)

Discover more about diseases related to Phosphoserine phosphatase Antibody (NBP1-56848).

Pathways for Phosphoserine phosphatase Antibody (NBP1-56848)

View related products by pathway.

PTMs for Phosphoserine phosphatase Antibody (NBP1-56848)

Learn more about PTMs related to Phosphoserine phosphatase Antibody (NBP1-56848).

Research Areas for Phosphoserine phosphatase Antibody (NBP1-56848)

Find related products by research area.

Blogs on Phosphoserine phosphatase

There are no specific blogs for Phosphoserine phosphatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol PSPH