PGD2 Synthase/PTGDS Antibody

Images

 
Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Analysis in human testis tissue.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Staining of human liver shows no positivity in hepatocytes as expected.
Western Blot: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Staining of human lateral ventricle shows strong cytoplasmic positivity in granular pattern in glial and neuronal cells.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Staining of human cerebral cortex shows strong positivity in neurons.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Staining of human heart shows strong positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: PGD2 Synthase/PTGDS Antibody [NBP1-81291] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGD2 Synthase/PTGDS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
Specificity
Specificity of human PGD2 Synthase/PTGDS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PTGDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PGD2 Synthase/PTGDS Protein (NBP1-81291PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGD2 Synthase/PTGDS Antibody

  • Beta-trace protein
  • Cerebrin-28
  • EC 5.3.99.2
  • Glutathione-independent PGD synthase
  • glutathione-independent PGD synthetase
  • lipocalin-type prostaglandin D synthase
  • Lipocalin-type prostaglandin-D synthase
  • L-PGDS
  • PDS
  • PGD2 Synthase
  • PGD2
  • PGDS2
  • PGDSLPGDS
  • PH2DISO
  • prostaglandin D synthase
  • prostaglandin D2 synthase (21kD, brain)
  • prostaglandin D2 synthase 21kDa (brain)
  • Prostaglandin-D2 synthase
  • prostaglandin-H2 D-isomerase
  • PTGDS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Hu, Mu, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45880
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
7954-GM/CF
Species: Hu
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81291
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PGD2 Synthase/PTGDS Antibody (NBP1-81291) (0)

There are no publications for PGD2 Synthase/PTGDS Antibody (NBP1-81291).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PGD2 Synthase/PTGDS Antibody (NBP1-81291) (0)

There are no reviews for PGD2 Synthase/PTGDS Antibody (NBP1-81291). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGD2 Synthase/PTGDS Antibody (NBP1-81291) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PGD2 Synthase/PTGDS Products

Bioinformatics Tool for PGD2 Synthase/PTGDS Antibody (NBP1-81291)

Discover related pathways, diseases and genes to PGD2 Synthase/PTGDS Antibody (NBP1-81291). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGD2 Synthase/PTGDS Antibody (NBP1-81291)

Discover more about diseases related to PGD2 Synthase/PTGDS Antibody (NBP1-81291).
 

Pathways for PGD2 Synthase/PTGDS Antibody (NBP1-81291)

View related products by pathway.

Blogs on PGD2 Synthase/PTGDS

There are no specific blogs for PGD2 Synthase/PTGDS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGD2 Synthase/PTGDS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PTGDS