SLC26A4 Antibody

Images

 
Immunohistochemistry-Frozen: SLC26A4 Antibody [NBP1-85237] - Human thyroid tissue was incubated with anti-SLC26A4 antibody at dilution 1:100 overnight at 4C and detected with Alexa Fluor 488 Donkey anti-rabbit at ...read more
Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human thyroid gland shows weak to moderate cytoplasmic and membranous positivity in follicle cells.
Immunohistochemistry-Paraffin: SLC26A4 Antibody [NBP1-85237] - Staining of human kidney shows strong positivity in apical membrane in a subset of cells in tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC26A4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRK
Specificity
Specificity of human SLC26A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC26A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC-Fr reported in verified customer review.
Control Peptide
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85237 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC26A4 Antibody

  • DFNB4
  • EVA
  • PDSTDH2B
  • pendrin
  • Sodium-independent chloride/iodide transporter
  • Solute carrier family 26 member 4
  • solute carrier family 26, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-80670
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59791
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP2-49271
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90226
Species: Hu
Applications: IHC, IHC-P
288-TPN/CF
Species: Hu
NBP2-47273
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-59652
Species: Hu, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-61141
Species: Hu
Applications: ICC/IF, IHC
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44270
Species: Rt
Applications: WB, EM, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-58026
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBL1-12547
Species: Hu
NBP1-85237
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P

Publications for SLC26A4 Antibody (NBP1-85237) (0)

There are no publications for SLC26A4 Antibody (NBP1-85237).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SLC26A4 Antibody (NBP1-85237) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-85237:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence SLC26A4 NBP1-85237
Enlarge
reviewed by:
Anonymous
IF Human 03/01/2019
View

Summary

ApplicationImmunofluorescence
Sample TestedThyroid tissue
SpeciesHuman
LotB118541

Comments

CommentsSLC26A4 (Pendrin) Antibody [NBP1-85237] - Human thyroid tissue was incubated with anti-SLC26A4 antibody at dilution 1:100 overnight at 4C and detected with Alexa Fluor 488 Donkey anti-rabbit (1:1000 Invitrogen, cat# A21206). Nuclei stained with DAPI.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC26A4 Antibody (NBP1-85237) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC26A4 Products

Bioinformatics Tool for SLC26A4 Antibody (NBP1-85237)

Discover related pathways, diseases and genes to SLC26A4 Antibody (NBP1-85237). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A4 Antibody (NBP1-85237)

Discover more about diseases related to SLC26A4 Antibody (NBP1-85237).
 

Pathways for SLC26A4 Antibody (NBP1-85237)

View related products by pathway.

PTMs for SLC26A4 Antibody (NBP1-85237)

Learn more about PTMs related to SLC26A4 Antibody (NBP1-85237).

Blogs on SLC26A4

There are no specific blogs for SLC26A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
03/01/2019
Application: IF
Species: Human

Bioinformatics

Gene Symbol SLC26A4