Reactivity | Hu, RtSpecies Glossary |
Applications | IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRK |
Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC26A4 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. SLC26A4 antibody validated for IHC-FR from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-85237 | Applications | Species |
---|---|---|
Karwelat D A rodent thyroid-liver chip to capture thyroid toxicity on organ functional level ALTEX 2022-07-05 [PMID: 35791291] (IF/IHC, Rat) | IF/IHC | Rat |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
IF | Human | 03/01/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for SLC26A4 Antibody (NBP1-85237)Discover more about diseases related to SLC26A4 Antibody (NBP1-85237).
| Pathways for SLC26A4 Antibody (NBP1-85237)View related products by pathway.
|
PTMs for SLC26A4 Antibody (NBP1-85237)Learn more about PTMs related to SLC26A4 Antibody (NBP1-85237).
| Research Areas for SLC26A4 Antibody (NBP1-85237)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SLC26A4 |