Peripherin Recombinant Protein Antigen

Images

 
There are currently no images for Peripherin Protein (NBP2-38444PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Peripherin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRPH.

Source: E. coli

Amino Acid Sequence: FSSTSYRRTFGPPPSLSPGAFSYSSSSRFSSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDFSMAEALNQEFLATRSNEKQEL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRPH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38444.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Peripherin Recombinant Protein Antigen

  • neurofilament 4 (57kD)
  • Neurofilament 4
  • peripherin
  • PRPH1NEF4

Background

Peripherin is a Class III intermediate filament subunit found in both the peripheral and central nervous systems, though it is concentrated--as its name suggests--in the neurons of peripheral ganglia and their processes. Antibodies to peripherin can be used in identifying, classifying, and studying neurons in the nervous system. Peripherin is also a good diagnostic marker for ballooned axons seen in Lou Gehrig's disease and some neuronally derived tumors. Peripherin is also a major component of the cytoskeleton of PC12 cells, a widely used model system for studies of neuronal differentiation. Autoantibodies to peripherin are frequently seen in the sera of patients with diabetes. Peripherin is not related to peripherin-RDS, a photoreceptor protein associated with retinal degeneration and blindness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86687
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87148
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
AF3844
Species: Hu, Mu
Applications: IHC
NBP2-58068
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P
NB300-140
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-131
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB300-133
Species: Bv, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KO, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-135
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, In vitro, WB
256-GF
Species: Hu
Applications: BA
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF3235
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-71774
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P

Publications for Peripherin Protein (NBP2-38444PEP) (0)

There are no publications for Peripherin Protein (NBP2-38444PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peripherin Protein (NBP2-38444PEP) (0)

There are no reviews for Peripherin Protein (NBP2-38444PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Peripherin Protein (NBP2-38444PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Peripherin Products

Research Areas for Peripherin Protein (NBP2-38444PEP)

Find related products by research area.

Blogs on Peripherin.

Successful Transplantation of Friedreich Ataxia Induced Pluripotent Stem Cell (iPSC)-Derived Sensory Neurons in Dorsal Root Ganglia of Adult Rodents
Jamshed Arslan, Pharm D, PhD The dorsal root ganglia (DRG) are a collection of cell bodies of sensory nerves carrying sensory information – including nociception, mechanoreception and proprioception – from periphera...  Read full blog post.

A Look at Peripherin: The Unknown Filament
The exact function of Peripherin, or Neurofilament 4, is unknown however it has been suggested to play a role in axon formation and determining and maintaining the shape of nerve cells. Peripherin is a 470 amino acid Class-III neuronal intermediate fi...  Read full blog post.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Peripherin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRPH