Peptidase Inhibitor 16/PI16 Antibody - BSA Free

Analysis in human plasma.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Peptidase Inhibitor 16/PI16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Peptidase Inhibitor 16/PI16 Antibody - BSA Free (NBP1-92254) is a polyclonal antibody validated for use in IHC and WB. Anti-Peptidase Inhibitor 16/PI16 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CEPIGSPEDAQDLPYLVTEAPSFRATEASDSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PI16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry Reported in scientific literature (PMID: 30365157)
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  Peptidase Inhibitor 16/PI16 Protein (NBP1-92254PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Peptidase Inhibitor 16/PI16 Antibody - BSA Free

• CRISP9
• CRISP-9
• Cysteine-rich secretory protein 9
• dJ90K10.5
• DKFZp586B1817
• MGC45378
• microseminoprotein, beta-binding protein
• MSMBBP
• Peptidase Inhibitor 16
• PI16
• PI-16
• protease inhibitor 16
• PSP94-binding protein
• PSPBP

Background

PI16 also known as Peptidase Inhibitor 16, has 2 isoforms, a 463 amino acid long isoform that is 49 kDa and a short 270 amino acid isoform that is 30 kDa; expressed in prostate, testis, ovary and intestine, concentrates in prostate cancer patient's sera; and acts as putative serine protease inhibitor. Disease research is currently being studied with relation to PI16 and prostate adenocarcinoma, adenocarcinoma, prostatitis, and prostate cancer. Little is currently known about PI16 protein interactions with other proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Peptidase Inhibitor 16/PI16 Antibody (NBP1-92254)(2)

Publications using NBP1-92254

• De Martin, A;Stanossek, Y;L�tge, M;Cadosch, N;Onder, L;Cheng, HW;Brandstadter, JD;Maillard, I;Stoeckli, SJ;Pikor, NB;Ludewig, B; PI16+ reticular cells in human palatine tonsils govern T cell activity in distinct subepithelial niches Nature immunology 2023-05-18 [PMID: 37202490] (Immunohistochemistry, Mouse)
• Lupsa N, Ersek B, Horvath A et al. Skin-homing CD8+ T cells preferentially express GPI-anchored peptidase inhibitor 16, an inhibitor of cathepsin K. Eur J Immunol 2018-11-09 [PMID: 30365157] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: PI16
• Entrez:
  • 221476(Human)
• Uniprot:
  • Q6UXB8(Human)