SLC15A4 Antibody


Western Blot: SLC15A4 Antibody [NBP1-87279] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SLC15A4 Antibody [NBP1-87279] - Staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human colon shows moderate to strong positivity in glandular cells.
Western Blot: SLC15A4 Antibody [NBP1-87279] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human endometrium shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Immunohistochemistry-Paraffin: SLC15A4 Antibody [NBP1-87279] - Staining of human testis shows moderate to strong positivity.
Simple Western: SLC15A4 Antibody [NBP1-87279] - Simple Western lane view shows a specific band for SLC15A4 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P

Order Details

SLC15A4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK
Specificity of human, mouse, rat SLC15A4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Simple Western 1:4
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SLC15A4 Protein (NBP1-87279PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC15A4 Antibody

  • Peptide transporter 4
  • Peptide/histidine transporter 1
  • PHT1hPHT1
  • PTR4peptide-histidine transporter 4
  • solute carrier family 15 member 4
  • solute carrier family 15, member 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, ICC/IF, IF
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for SLC15A4 Antibody (NBP1-87279) (0)

There are no publications for SLC15A4 Antibody (NBP1-87279).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC15A4 Antibody (NBP1-87279) (0)

There are no reviews for SLC15A4 Antibody (NBP1-87279). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC15A4 Antibody (NBP1-87279). (Showing 1 - 1 of 1 FAQ).

  1. I am interested in an antibody against Slc15a4. I would like to use it for mouse and human tissues for WB and IHC experiments. I have seen that the antibody NBP1-87279 targeting the human protein has been used to detect also rat and mouse protein in WB. Do you know whether cross reactivity also exists for IHC with mouse samples? And are there any specific references, where this antibody has been used?
    • NBP1-87279 has been validated for mouse and rat cross reactivity using Western blot and we do not currently have any testing data for IHC in these 2 species.

Secondary Antibodies


Isotype Controls

Additional SLC15A4 Products

Bioinformatics Tool for SLC15A4 Antibody (NBP1-87279)

Discover related pathways, diseases and genes to SLC15A4 Antibody (NBP1-87279). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC15A4 Antibody (NBP1-87279)

Discover more about diseases related to SLC15A4 Antibody (NBP1-87279).

Pathways for SLC15A4 Antibody (NBP1-87279)

View related products by pathway.

PTMs for SLC15A4 Antibody (NBP1-87279)

Learn more about PTMs related to SLC15A4 Antibody (NBP1-87279).

Blogs on SLC15A4

There are no specific blogs for SLC15A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC15A4 Antibody and receive a gift card or discount.


Gene Symbol SLC15A4