Pentraxin 3/TSG-14 Antibody (2B10) - Azide and BSA Free Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
PTX3 (NP_002843, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV |
Localization |
Secreted |
Specificity |
PTX3 - pentraxin-related gene, rapidly induced by IL-1 beta |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PTX3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Pentraxin 3/TSG-14 Antibody (2B10) - Azide and BSA Free
Background
Pentraxin 3 (PTX3) is the prototypic member of the long pentraxin family sharing the C-terminal domain with short pentraxins (C-reactive protein and serum amyloid P component) and containing a unique N-terminal domain. The protein is a soluble pattern recognition receptor and represents a nonredundant component of the humoral innate immunity against selected pathogens. PTX3 is rapidly produced and released at inflammatory sites by diverse cell types including monocytes/macrophages, endothelial cells, vascular smooth muscle cells, fibroblasts, and adipocytes. It interacts with several ligands, including growth factors, extracellular matrix components and selected pathogens. PTX3 has been implicated in vascular damage, angiogenesis, atherosclerosis, and restenosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Bind
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Mu
Applications: ELISA
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Publications for Pentraxin 3/TSG-14 Antibody (H00005806-M02)(2)
Showing Publications 1 -
2 of 2.
Reviews for Pentraxin 3/TSG-14 Antibody (H00005806-M02) (0)
There are no reviews for Pentraxin 3/TSG-14 Antibody (H00005806-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Pentraxin 3/TSG-14 Antibody (H00005806-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pentraxin 3/TSG-14 Products
Research Areas for Pentraxin 3/TSG-14 Antibody (H00005806-M02)
Find related products by research area.
|
Blogs on Pentraxin 3/TSG-14