Pentraxin 2/SAP Antibody - BSA Free

Western Blot: Serum Amyloid P Antibody [NBP2-31392] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry: Serum Amyloid P Antibody [NBP2-31392] - Staining of human duodenum shows positivity in plasma.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pentraxin 2/SAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: APCS
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pentraxin 2/SAP Antibody - BSA Free

• 9.5S alpha-1-glycoprotein
• amyloid P component, serum
• APCS
• MGC88159
• Pentraxin 2
• PTX2
• PTX2serum amyloid P-component
• SAP
• SAPpentaxin-related
• Serum Amyloid P component

Background

Serum Amyloid P (SAP) is a non-fibrillar plasma glycoprotein that belongs to the pentraxin family. It is universally found in amyloid deposits and this is probably due to its specific calcium-dependent binding to motifs present on all types of amyloid fibrils. SAP is also found to prevent fibrillar breakdown by enzymes and it is believed that it helps maintains stability of the amyloid deposits (1,2). It has been shown that SAP binds monocytes with high avidity, but does not bind to erythrocytes, NK cells, T lymphocytes or B lymphocytes (3). SAP production can be induced by exposure to IL-1, IL-6 and IFN-beta. The SAP-inducing activity was neutralized by antibodies to each of the recombinant cytokines (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: APCS
• Uniprot:
  • P02743()