Pentraxin 2/SAP Antibody

Images

 
Western Blot: Serum Amyloid P Antibody [NBP2-31392] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more
Immunohistochemistry: Serum Amyloid P Antibody [NBP2-31392] - Staining of human duodenum shows positivity in plasma.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pentraxin 2/SAP Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APCS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Pentraxin 2/SAP Recombinant Protein Antigen (NBP2-31392PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pentraxin 2/SAP Antibody

  • 9.5S alpha-1-glycoprotein
  • amyloid P component, serum
  • APCS
  • MGC88159
  • Pentraxin 2
  • PTX2
  • PTX2serum amyloid P-component
  • SAP
  • SAPpentaxin-related
  • Serum Amyloid P component

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004068-M01
Species: Hu
Applications: WB, ELISA
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4779
Species: Hu
Applications: WB, IHC

Publications for Pentraxin 2/SAP Antibody (NBP2-31392) (0)

There are no publications for Pentraxin 2/SAP Antibody (NBP2-31392).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pentraxin 2/SAP Antibody (NBP2-31392) (0)

There are no reviews for Pentraxin 2/SAP Antibody (NBP2-31392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pentraxin 2/SAP Antibody (NBP2-31392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pentraxin 2/SAP Products

Bioinformatics Tool for Pentraxin 2/SAP Antibody (NBP2-31392)

Discover related pathways, diseases and genes to Pentraxin 2/SAP Antibody (NBP2-31392). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pentraxin 2/SAP Antibody (NBP2-31392)

Discover more about diseases related to Pentraxin 2/SAP Antibody (NBP2-31392).
 

Pathways for Pentraxin 2/SAP Antibody (NBP2-31392)

View related products by pathway.

Blogs on Pentraxin 2/SAP

There are no specific blogs for Pentraxin 2/SAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pentraxin 2/SAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APCS
Entrez
Uniprot