Pentraxin 2/SAP Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Pentraxin 2/SAP Antibody - BSA Free (NBP2-31392) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: QEQDSYGGKFDRSQSFVGEIGDLYMWDSVLPPENILSAYQGTPLPANILDWQALNYEIRGYVIIKPLVWV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
APCS |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Pentraxin 2/SAP Antibody - BSA Free
Background
Serum Amyloid P (SAP) is a non-fibrillar plasma glycoprotein that belongs to the pentraxin family. It is universally found in amyloid deposits and this is probably due to its specific calcium-dependent binding to motifs present on all types of amyloid fibrils. SAP is also found to prevent fibrillar breakdown by enzymes and it is believed that it helps maintains stability of the amyloid deposits (1,2). It has been shown that SAP binds monocytes with high avidity, but does not bind to erythrocytes, NK cells, T lymphocytes or B lymphocytes (3). SAP production can be induced by exposure to IL-1, IL-6 and IFN-beta. The SAP-inducing activity was neutralized by antibodies to each of the recombinant cytokines (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, WB
Publications for Pentraxin 2/SAP Antibody (NBP2-31392) (0)
There are no publications for Pentraxin 2/SAP Antibody (NBP2-31392).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pentraxin 2/SAP Antibody (NBP2-31392) (0)
There are no reviews for Pentraxin 2/SAP Antibody (NBP2-31392).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Pentraxin 2/SAP Antibody (NBP2-31392) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pentraxin 2/SAP Products
Research Areas for Pentraxin 2/SAP Antibody (NBP2-31392)
Find related products by research area.
|
Blogs on Pentraxin 2/SAP