PEDFR/PNPLA2/ATGL Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEDF R/PNPLA2/ATGL. Source: E. coli Amino Acid Sequence: SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PNPLA2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58046. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen
Background
Patatin-like phospholipase domain-containing protein 2 (PNPLA2), also known as adipose triglyceride lipase (ATGL), is a lipolytic enzyme required for mobilization of fatty acids from triglyceride stores in adipose tissue. Until recently, hormone-sensitive lipase (HSL) was the only enzyme known to hydrolyze triglycerides in mammalian adipose tissue. However, ATGL has now been shown to catalyze the initial step of triglyceride hydrolysis in adipocyte and non-adipocyte lipid droplets. Thus, ATGL and HSL coordinate to catabolize stored triglycerides in adipose tissue of mammals.
Defects in PNPLA2 can lead to neutral lipid storage disease with myopathy (NLSDM), a neutral lipid storage disorder with myopathy but without ichthyosis.
ATGL antibodies can serve as useful tools for adipocyte studies and research on triglyceride processing and fat storage.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Fi, Hu, Mu, Po, Rt
Applications: Flow, IMC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AC
Publications for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP) (0)
There are no publications for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP) (0)
There are no reviews for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP) (0)
Additional PEDFR/PNPLA2/ATGL Products
Research Areas for PEDFR/PNPLA2/ATGL Recombinant Protein Antigen (NBP2-58046PEP)
Find related products by research area.
|
Blogs on PEDFR/PNPLA2/ATGL