PDXP Antibody

Images

 
Western Blot: PDXP Antibody [NBP1-56888] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDXP Antibody Summary

Immunogen
Synthetic peptides corresponding to PDXP(pyridoxal (pyridoxine, vitamin B6) phosphatase) The peptide sequence was selected from the middle region of PDXP. Peptide sequence DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDXP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PDXP and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PDXP Antibody

  • chronophin
  • CIN
  • dJ37E16.5
  • EC 3.1.3
  • EC 3.1.3.74
  • FLJ32703
  • PLP phosphatase
  • PLP
  • PLPP
  • pyridoxal (pyridoxine, vitamin B6) phosphatase
  • pyridoxal phosphate phosphatase

Background

Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87781
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-24763
Species: Hu, Pm
Applications: IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-24614
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
NBP1-87345
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87343
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP2-48909
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
538-MG
Species: Rt
Applications: BA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
NBP2-46617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
285-IF
Species: Hu
Applications: BA
NBP1-56888
Species: Hu
Applications: WB

Publications for PDXP Antibody (NBP1-56888) (0)

There are no publications for PDXP Antibody (NBP1-56888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDXP Antibody (NBP1-56888) (0)

There are no reviews for PDXP Antibody (NBP1-56888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDXP Antibody (NBP1-56888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDXP Products

Array NBP1-56888

Bioinformatics Tool for PDXP Antibody (NBP1-56888)

Discover related pathways, diseases and genes to PDXP Antibody (NBP1-56888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDXP Antibody (NBP1-56888)

Discover more about diseases related to PDXP Antibody (NBP1-56888).
 

Pathways for PDXP Antibody (NBP1-56888)

View related products by pathway.

PTMs for PDXP Antibody (NBP1-56888)

Learn more about PTMs related to PDXP Antibody (NBP1-56888).
 

Research Areas for PDXP Antibody (NBP1-56888)

Find related products by research area.

Blogs on PDXP

There are no specific blogs for PDXP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDXP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDXP
Uniprot