PDP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PDP2 Antibody [NBP2-57082] - Staining of human cell line PC-3 shows localization to mitochondria.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PDP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VPPTLNSSPCGGFTLCKAYRHTSTEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PDP2 Recombinant Protein Antigen (NBP2-57082PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PDP2 Antibody - BSA Free

• EC 3.1.3
• EC 3.1.3.43
• KIAA1348[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
• PDP 2
• PDPC 2
• PPM2C2
• protein phosphatase 2C, magnesium-dependent, catalytic subunit 2
• Pyruvate dehydrogenase phosphatase catalytic subunit 2
• pyruvate dehydrogenase phosphatase isoenzyme 2
• pyruvate dehydrogenase phosphatase, catalytic subunit 2
• pyruvate dehyrogenase phosphatase catalytic subunit 2

Background

PDP2 catalyzes the first committed step in the biosynthesis of complex N-glycans. It controls conversion of high mannose to complex N-glycans; the final hydrolytic step in the N-glycan maturation pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PDP2